EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02218 alignment
(18 sequences with 37 aa)


SRC8_HUMAN/157-193 GFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSK
O70419_RAT/120-156 GFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSS
O70419_RAT/194-230 GFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVK
O96459_STRPU/231-267 GFGGKYGVQKDSQDSSAVGFDYEGKTEKHASQTDSSK
O96459_STRPU/194-230 GFGGKHGVQTDRQDASAVGFDYEGKTEKHASHKDYSS
O96459_STRPU/120-156 GFGGKHGVQSDRQDASAVGFDYEGKTDKPASQKDYSS
HCLS1_HUMAN/119-155 GFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSR
SRC8_MOUSE/268-304 GFGGKFGVQSERQDSSAVGFDYKERLAKHEPQQDYAK
SRC8_CHICK/277-313 GFGGKFGVQTERQDPSAVGFDYKEKLAKHESQQDYSK
O96046_DROME/158-194 GFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSK
O96046_DROME/121-157 GFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYAT
O70420_RAT/231-267 GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAK
O96459_STRPU/157-193 GFGGKFGVQKQSMDKSAVGWDYQAGLSQHNSQKDYST
O96046_DROME/84-120 GYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSD
O70419_RAT/83-119 GYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVR
O96459_STRPU/83-119 GYGGKFGVQQDRMDKSAVGHDHQESLNKHASQADYAK
HCLS1_HUMAN/82-118 GYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAK
HCLS1_HUMAN/156-192 GFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAK