EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02217 alignment
(7 sequences with 131 aa)


TALA_POVMK/152-274 DMPADLMEYLSCAILSNKTLPCFLIYTTLEKVELLYNKLSEE----VLSPRFN-QVDHKYGRKYVPIFIITGTKHRVSAVFNYCATYCSVSFIVVKGVIKEYPLYCHLCV-EPYSVLQESIE-ELNSEFF-
TALA_SV40/137-258 DFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIME-----KYSVTFI-SRHNSYN-HNI-LFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTR-DPFSVIEESLPGGLKEHDFN
TALA_POVLY/201-325 DFPVCLYSFLSHAIYSNKTMNSFLIYTTLEKARQLYKTVEKSKIVVDFKASFS-YQDEEGE-GCL-LFLITLGKHRVSAVKHFCVSQCTFSFIHCKAVVKPLELYKTLSK-PPFKLLEENKPG-VSMFEF-
TALA_POVMC/286-405 DFPSSLTGYLSHAIYSNKTFPAFLVYSTKEKCKQLYDTIGK------FRPEFK-CLVHYEE-GGM-LFFLTMTKHRVSAVKNYCSKLCSVSFLMCKAVTKPMECYQVVTA-APFQLITENKP-GLHQFEFT
TALA_POVHA/262-383 DFPTILRGFLSHAIFSNKTQNAFIIYSTKEKCEVLYEQIDK------YNPDYKGIFIMKQT-EAF-VMFMTPGKHRVAAVKSYCCKFCTVSFLLCKAVTKPLELYNCVAKCDDFQILKENKPG-LYHFEFC
TALA_POVBO/97-216 DFPEVLKEYVSNALFTNRTYNCFIIFTTAEKGKELYPCIQAA-----YKCTFI-ALYMYNG-DSV-LYIITVGKHRVNAMENLCSKKCTVSFLQAKGVLKPQEAYNVCCT---FELISQNIQGGLPSSFFN
Q9IBL1_BFDV/112-225 ELPPEVEAYLLTPRSVQSCPDCHLLITSITKMPQLKAHLYE-----HFGIKGH-MLAHWTG-IAL-LVLQLEKPTRISTVHNFCKKYCTISICSVRGIKKNCVH--ALIK-TLLDV-----PG-LDLEECS