EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02203 alignment
(10 sequences with 141 aa)


MCP3_ECOLI/47-185 DRDQRDVTAEIEIRTGLANSSDFLRSARINMIQAGAASRIAEMEAMKRNIAQAESEIKQSQQGYRAYQNRPVKTPADEALDTELNQRFQAYITGMQPMLKYAKNG-MFEAIINHE-SEQIRPLDNAYTDILNKAVKIRSTR
MCP4_ECOLI/44-177 EQSNQQRAALAQTRAVMLQASTALNKAGTLTA---LSYPADDIK--TLMTTARAS-LTQSTTLFKSFMAMTAGNEHVRGLQKETEKSFARWHNDLEHQATWLESN-QLSDFLTAPVQGSQNAFDVNFEAWQLEINHVLEAA
MCPC_SALTY/43-180 SALSYQQQELGGSFQTLIETRVTINRVAIRML-KNQRDPASLDAMNTLLTNAGAS-LNEAEKHFNNYVNSEAIAGKDPALDAQAEASFKQMYDVLQQSIHYLKAD-NYAAYGNLDAQKAQDDMEQVYDQWLSQNAQLIKLA
MCPD_ENTAE/43-174 LPSVASTDALSLSWVSLLQARNTLNRAGTRGA---EGAAGAGGS--ALMAAPAAR-CKKPISILTSS--STRLARMSRNSSWPMPRVIATRIYALRELIVFLENR-NLQAFMDQPTQKIQDRFEADFVQYLQLAKATTDEA
MCPS_ENTAE/44-183 QTIRQQQLLLSESRVDLLQARNSLNRAGIRYM-MDTNKIGSGATIDELLAKAEKEKLARAERNYTAYEKIPQDPRQDPQATEKLKQQYGILYGALSELIQLLGGGCKINAFFDQPTQKYQDDFEQTYNAYLQQNGKLYQIA
MCP1_ECOLI/44-181 QTIRQQQSTLNGSWVALLQTRNTLNRAGIRYM-MDQNNIGSGSTVAELMESASIS-LKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNALAELIQLLGAG-KINEFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIA
MCP2_SALTY/44-179 NELRQQQSELTSTWDLMLQTRINLSRSAARMM-MDASNQQSSAKT-DLLQNAKTT-LAQAAAHYANFKNMTPLP-AMAEASANVDEKYQRYQAALAELIQFLDNG-NMDAYFAQPTQGMQNALGEALGNYARVSENLYRQT
MCPA_BACSU/33-150 AIFAYQSASSSLDRQMMGSALENVQQLNEIIN----TSIGEKE---NSADYFSEW-LTKEKYNAKSN--------------ASIREKFSQYISINKDVESIYTSD-TKGHFTRYPDLPMPSGYNPVERDWYKKAVANKGKV
TLPB_BACSU/33-150 AYFSYQSAWNALDRELISSAKGNVEELNSTLQ----NKLEDKV---KAIDYYSET-VDKDILLGKNK--------------TLLKEKFKQYTTLNDDVGAIYAAS-EDKKLYKYPDSGVPKGFDPTGRDWYKQAVAEKGQA
O05244_BACSU/36-154 EFSSYRSASGKLDQEIMGNAKNSVDTFNTTVT----NDLGEKA---KAVTFFSES-LKRSAFKGKSN-------------QEEIKAKFSQYVSINQGVARIYGGA-DNGTYVQAPKEKLPEGYDPRQRPWYQDAMKAGGEI