EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02200 alignment
(4 sequences with 111 aa)


STEA_EMENI/56-165 DQLIRRFLLPTGD-YISCVLWSNLFHISGTDIVRCLAFRFQAFGRPVKNSKKFEEGIFSDLRNLKAGTDATLEEPKSPFLDFLYKNNCIRTQKKQKVFYWYSVPHDRLFLD
O42722_CRYNE/91-200 HPNLNRFLLPNGE-YVACVFWNGLYHITGTDIIRALVFRFKAFSRPVRNMKKFEEGVFSDLRNLKPGTDACLEEPKSPFLDLLFRNGCIRTQKKQKVFYWFSVPHDRLFLD
STE12_KLULA/51-161 NQVIRRYYLSNDEGFVSCVFWNNLYYITGTDIVRCCAYRMQKFGREIVERKKFEEGIFSDLRNLKCGIDATLEKPKSDLLAFLYKNMCLKTQKKQKVFFWFSVPHDRLFAD
CPH1_CANAL/44-154 NQVIRRYYLNHDEGFVSCVYWNNLYFITGTDIVRCIVYKFEHFGRKIIDRKKFEEGIFSDLRNLKCGADAILEPPRSEFLEFLFKNSCLRTQKKQKVFFWFNVPHDKLMAD