EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02184 alignment
(3 sequences with 33 aa)


O16376_CAEEL/201-233 KEIDRARSVYQRFLHVHGINVQNWIKYAKFEER
CWF4_SCHPO/185-216 HENERARGIYERFVVVH-PEVTNWLRWARFEEE
CRN_DROME/191-222 KEIDRAREIYERFVYVH-PDVKNWIKFARFEES