EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02182 alignment
(4 sequences with 167 aa)


SUVH5_ARATH/360-519 GTQIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMK---DDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVG--KKK--NNEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKNTTLQSSVVAKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQ
SUVH6_ARATH/325-486 GVHILGEVPGVEVGDEFQYRMELNILGIHKPSQAGIDYMK----YGKAKVATSIVASGGYDDHLDNSDVLTYTGQGGNVMQVKKKGEELKEPEDQKLITGNLALATSIEKQTPVRVIRGKHKSTHDKS-KGGNYVYDGLYLVEKYWQQVGSHGMNVFKFQLRRIPGQ
SUVH2_ARATH/202-358 DKHIVGPVTGVEVGDIFFYRMELCVLGLHGQTQAGIDCLTAERSATGEPIATSIVVSGGYEDDEDTGDVLVYTGHGGQDH-------QHKQCDNQRLVGGNLGMERSMHYGIEVRVIRGIK---YENSISSKVYVYDGLYKIVDWWFAVGKSGFGVFKFRLVRIEGQ
O81463_ARATH/228-374 AEHDPVRNQGVLVGESWENRVECRQWGVHLPHVSCIAGQE-------DYGAQSVVISGGYKDDEDHGEWFLYTGRSRG---------RHFANEDQEFEDLNEALRVSCEMGYPVRVVRSYKDR-YSAYAPKEGVRYDGVYRIEKCWRKARFP---VCRYLFVRCDNE