EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02176 alignment
(14 sequences with 60 aa)


TRAF6_MOUSE/151-200 HQV-HCEFALVNCPQ--CQ-RPFQKCQVNTHIIEDCPRRQVSCVN----CAVSMAYEE--
TRAF6_MOUSE/204-258 HDQ-SCPLANIICEY--CG-TILIREQMPNHYDLDCPTAPIPCTFSVFGCHQKMQRNHL-
DG17_DICDI/194-250 HYK-TCPMVPIDCSQ-GCS-VKIERKSIIDHIENDCCNTQIPCKYFEQGCKVEMKRSELQ
TRAF2_HUMAN/178-233 HHE-VCPKFPLTCDG--CGKKKIPREKFQDHVKT-CGKCRVPCRFHAIGCLETVEGEKQQ
TRAF2_MOUSE/178-233 HYE-VCPKFPLTCDG--CGKKKIPRETFQDHVRA-CSKCRVLCRFHTVGCSEMVETENLQ
TRAF4_HUMAN/210-266 HQY-QCPRLPVACPN-QCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAM-
TRAF5_HUMAN/183-239 HEENLCPEYPVFCPN-NCA-KIILKTEVDEHLAV-CPEAEQDCPFKHYGCAVTDKRRNLQ
TRAF3_HUMAN/192-249 HEDTDCPCVVVSCPH-KCSVQTLLRSELSAHLSE-CVNAPSTCSFKRYGCVFQGTNQQIK
O62248_CAEEL/152-208 HPK-TCPQVIISCPF-QCGLTDRPRLEIEAHCPS-CPNVDNVCPFVPYGCTFAGGKESIQ
TRAF4_HUMAN/102-154 HLN-TCSFNVIPCPN-RCP-MKLSRRDLPAHLQHDCPKRRLKCEF----CGCDFSGEAYE
TRAF3_HUMAN/136-190 HLKNDCHFEELPCVRPDCK-EKVLRKDLRDHVEKACKYREATCSH----CKSQVPMIALQ
TRAF5_MOUSE/128-181 HLQ-HCSFQAVPCPNESCR-EAMLRKDVKEHLSAYCRFREEKCLY----CKRDIVVTNLQ
TRAF5_HUMAN/128-181 HLQ-QCLFQPVQCSNEKCR-EPVLRKDLKEHLSASCQFRKEKCLY----CKKDVVVINLQ
TRAF4_HUMAN/156-208 HEG-MCPQESVYCEN-KCG-ARMMRRLLAQHATSECPKRTQPCTY----CTKEFVFDTIQ