EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02155 alignment
(2 sequences with 386 aa)


GCR_XENLA/29-401 VIEFFGNYRGGVSVSVSASCP-TSTASQSNTRQQQHFQKQLTATGDSTNGLNNNVPQPDLSKAVSLSMGLYMGESDTKVMSSDIAFPSQEQIGISTGETDFSLLEESIANLQAKSLAPDKLIEISE-----DP---GGFKCD--ISAQPRPSMGQGGSNGSSSTNLFPKDQCTFDLLRDLGISPDSP-LDGKSNPWLDPLFDEQEAFNLLSPLGTGDPFFMKSEVLSEGSKTLSLEDGTQRLGDHAKDMLLPSADRPISQVKTEKEDYIELCTPGVVNEEKFGPVYCVGNFSGSGLFGNKSSAISVHGVSTSGGQMYHYDLNTATISQQ-DVKPVFNLGSPGTSIAEGWNRCHGSGNDTAASPGNVNFPNRSVFSNGYSSPGIRSD
GCR_SAISC/26-401 VMDFCKILRGGATLKVSVSSTSLAAASQSDSKQQ-------RLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLQLLEESIANLNRSTSVPENPKSSASSSVSAAPKEKEFPKTHSDVSSEQQNLKGQTGTNG-GNVKLYTADQSTFDILQDLEFSSGSPGKETNQSPWKSDLLIDENC--LLSPLAGEEDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSSSNVTLPQVKTEKEDFIELCTPGVIKQEKLSTVYCQASFPGANIIGNKMSAISIHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPD