EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02152 alignment
(17 sequences with 118 aa)


FAS_YEAST/189-297 VRISELKMLTLIGVFTFERLKKQYVTLDIKLPWP--KKAELP------PPVQSIIDNVVKFVEESN.FKTVEALVESVSAVIAHNEYFQKFPDSPLVVKVLKLNAITATEGVGVSCIR
O75013_SCHPO/132-232 IEFSDLELATILGIHAFERQEKQRVCLNISFANT-------------EVEALEIARAIAEYVEQSA.FLTIEALVVNLSKYLCFTK---NLDDISIKAEKPSAITFANASAVQIYRTR
FAS_PNECA/163-276 FFIKNLSLYTIIGINPEERVNKQNIIIDLILFKSSINLECKDDFIINTYNIEKLLKEIVKHVEEST.FKTIEALALSIARISCISH---NIEKIIVKVKKSCALAFAESAGVEIVRSR
FOLX_ECOLI/7-117 IRIKNLRLRTFIGIKEEEINNRQDIVINVTIHYP-ADKARTSEDINDALNYRTVTKNIIQHVENNR.FSLLEKLTQDVLDIAREHH---WVTYAEVEIDKLHALRYADSVSMTLSW--
FOLB_ECOLI/4-114 VFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWD-NRKAAKSDDVADCLSYADIAETVVSHVEGAR.FALVERVAEEVAELLLARF---NSPWVRIKLSKPGAVARAANVGVIIER--
FOLB_HAEIN/4-114 VFIEELTVFAQIGVYDWEQQIKQKLVFDLEMAWD-CKQAAETDDVVYCLNYAEVSQAIIDYVESKP.FLLIERVAYEVADLLESRY---QLQGLKIKLSKPKAVAQARNVGVLIVR--
FOLB_BACSU/4-117 VYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELD-LSKAGQTDDLEQTINYAELYHVCKDIVEGEP.VKLVETLAERIAGTVLGKFQ--PVQQCTVKVIKPDPPIPGHYKSVAIEITR
FOLB_STRPY/4-117 IVLEGCRFYGYHGAFKEEQTLGQIFLVDLELSVD-LQAASLSDQLTDTVHYGMVFDSVRQLVEGEK.FILIERLAGAICEQLFNEFP--PIEAIKVAIKKENPPIAGHYKAVGIELER
FOLB_METEX/5-118 ILVHRLAVFARHGVLPEEERLGQRFYISLECRLD-LAPAGRSDDVAATVSYADLAEIALEIASNRR.FALIEALAEAIAETCLARFP--RIETIAVRIDKPSAPIPAVLDYAAIEIVR
FOLB_MYCTU/5-117 IELRGLTVHGRHGVYDHERVAGQRFVIDVTVWID-LAEAANSDDLADTYDYVRLASRAAEIVAGPP.RKLIETVGAEIADHVMDDQ---RVHAVEVAVHKPQAPIPQTFDDVAVVIRR
SULD_STRPN/4-117 LQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYD-MTKAATDLDLTASVHYGELCQQWTTWFQETS.EDLIETVAYKLVERTFEFYP--LVQEMKLELKKPWAPVHLSLDTCSVTIHR
FOLB_CHLTR/6-121 LDIADFRVWVSIGVSEQERHYPQPVLVSLSLFFKEEPKACSTDKVSDSVCYAELVSLIEEVATNNP.CALIERLAKVLLEKIEKALAG-QVSRIDLRVSKERPPIPDLLSPVSFSISR
FOLB_CHLPN/9-124 LIISKFRMWLFLGCSVEERHFKQPVLISVTFSYNEVPSACLSDKLSDACCYLEVTSLIEEIANTKP.YALIEHLANELFDSLVISFGD-KASKIDLEVEKERPPVPNLLNPIKFTISK
FAS_PNECA/41-152 IHIHSLTLKSIVGKNSWAQRLLQPVVLTLSMGIN-ASLSGNMDDLSYSIDYATVYKEVFKLVENSK.FENLLDLSDKISKVVLGDK--CKGNWVKVIAETPKGHLLAETGLQIIRR--
O75013_SCHPO/8-120 VVVENLNTFAVVGQDQWKRKEPQPVQIDVYMRNN-VQLAGEKDELKSTIHYGIASKLLRKEIEGSF.FTTPKDLVNKIASLCFEDVI--DTSHVSIKLTLPKCVLRSKNGLHYYAER-
FAS_YEAST/64-178 VHIKKLEMNTVLGPDSWNQLMPQKCLLSLDMGTD-FSKSAATDDLKYSLNYAVISRDLTNFVSKKKnWGSVSNLAKSVSQFVMDKYS--GVECLNLEVQADTTHIRSDHISCIIQQER
Q9ZJB0_HELPJ/7-113 VHIHNLVFETILGILEFERLKPQKISVDLDLFYT-ELPNKAY------LDYMEIQEIIQNTMREKQ.YLLIEDALKDLSQILKTRY---KKISELFLKISKLEISPNSQVGASMKIYY