EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02149 alignment
(11 sequences with 50 aa)


Q43475_HORVU/435-483 GDKSTHIVKFEIQLYKT-RGDKYLLDLQRVSGPQLLFLDLCSAFLTQLRV
O04122_SOLTU/465-513 DTKLTNVVKFEVQLYKT-REEKYLLDLQRIQGPQFLFLDLCAAFLAQLRV
KIN10_ARATH/486-534 AVKSPNVVKFEIQLYKT-RDDKYLLDLQRVQGPQFLFLDLCAAFLAQLRV
P92958_ARATH/463-511 AMTSPTVIKFELQLYKA-REEKYLLDIQRVNGPQFLFLDLCAAFLTELRV
O81992_HORVU/464-512 DGRLPAVVKFEIQLYKT-KDNKYLLDIQRVTGPQLLFLEFCGAFLTNLRV
Q41485_SOLTU/454-502 HLQPQPTVKFEMQLYKT-EDEKYLLDLQRISGPQFLFLDFCAGFIRQLEG
KIN1_YEAST/1015-1064 TTTEKEPIKFEIHIVKVRIVGLAGVHFKKISGNTWLYKELASSILKELKL
KIN1_SCHPO/842-891 GESPASNLAFEIYIVKVPILSLRGVSFHRISGNSWQYKTLASRILNELKL
O08678_RAT/744-793 DARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
O45370_CAEEL/93-142 DPLTDASVKWDIEVCTLPRLYLNGVHFQRISGSSSDFKNITTKISEELDI
MELK_HUMAN/602-651 SDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV