EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02135 alignment
(9 sequences with 97 aa)


Q39717_TOBAC/468-547 PRERQYLNQKRWLLFLIHARRCSAPE---GK------------CPENNCIHAQKLLRHMERCIKF-DCPYPRCPETKVLIN-HHKHCKNENCPVCIP
O64548_ARATH/509-588 NRDPRFKNQQKWLLFLRHARHCKAPE---GK------------CPDRNCVTVQKLWKHMDSCAAP-QCSYPRCLPTKTLIN-HHRSCKEPNCPVCIP
CBP_MOUSE/347-431 PEKRK-LIQQQLVLLL-HAHKCQRREQANGEVRA---------CSLPHCRTMKNVLNHMTHCQAPKACQVAHCASSRQIIS-HWKNCTRHDCPVCLP
O44076_CAEEL/4-97 PEKRK-LIQQQLVLLL-HAHKCSQREKENRDFAAKNQPPPHAACTLPHCSTMKEVLTHMTSCNVGRLCHFAHCASSRQIIA-HWKNCSREDCPVCKP
O01368_DROME/508-593 PDDRKRQIQQQLMLLL-HAHKCNRRENLNPNREV---------CNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILL-HYKTCQNSGCVICYP
O17681_CAEEL/48-141 PHILK-VIKEQLILLL-HANVCTKRDRENYQAAINGQPARHPRCDLPSCGLFKYTLSHLNMCTNGSHCLIDYCNTSKQLIK-HWRECQNRACAICAP
CBP1_CAEEL/1549-1628 AGGTRYESIQRCIASLVHACQCRDAN-----------------CRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFC
O01368_DROME/2391-2470 PQEARKQSIQRCIQSLAHACQCRDAN-----------------CRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFC
O64548_ARATH/1436-1515 ARQLRVLQLRKMLDLLVHASQCRSAH-----------------CQYPNCRKVKGLFRHGINCKVRASGGCVLCKKMWYLLQLHARACKESECHVPRC