EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02121 alignment
(5 sequences with 265 aa)


O62119_CAEEL/1-253 MLIKEYRILLPMTVQEYRIAQLYMIQKKSRLDSHGQDSGVEIISNKPYTDGPGGSGQYTFKIYHIGSRIPAWIRTVLPTNALEAHEESWNAYPVTKTRYSTP-MMDRFSLEVETLYFDDHGQQENVFNLNEKDKSTRIIDYMDFVK-DPISSHDYCAEEDPKLYRSETTNRGPLNDDWVAEHLKKG-.........LPIMCAYKLCKVEFRYWGMQTRAERWIHDLALRNTMMRAHRQAWAWQDEWTGLTMNDIRKLEAEAALHL
O02434_DROME/1-263 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAMECYPYTRTRYTCP-FVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVK-DQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKgkkqptprnMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLAL
O00562_HUMAN/1-252 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCP-FVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVR-DAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTAAQTG-.........-PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMADIRALEEETARML
PIPNB_MOUSE/1-253 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGG-GEGIEVLKNEPYEND-GEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLGPNWKKELANTPD.........CPRMCAYKLVTIKFKWWGLQSKVENFIQKQ-EKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKEL
PIPNA_HUMAN/1-253 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGG-GEGVEVLVNEPYEKD-GEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKD.........CPYMCAYKLVTVKFKWWGLQNKVENFIHKQ-ERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQL