EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02120 alignment
(15 sequences with 150 aa)


Q9WZE0_THEMA/463-606 SEKPLFQNREKNQPMEMKMKYEEKGKIESYREITNREALEFLSQERAKQVYSLPELKRTETVHLPRFV-EQM.-.-YYHKTERAVIDLEPPELGKLEITITKEENQL.KIVFRVQTEEAKHVLEHDIPRLIERFNEKGFDVQVYVEKQEE
O34003_RHOSH/519-661 VGQDGAETALAVEPAGATLAGSDPVAPAPLTALPSDLRLERAGEPRAGADGPLALAAPDAPAELQDRILE--.-.-AAAGEGEIEIVLAPETLGRLRIRVEMRDGTA.QVSFTTETAEAARLLSGQEGRLSDLLEKHGLSLGRHEAGQGD
Q9Z6G3_VIBPA/448-591 LSAGALKATASQQDKPESQYGLAGQLQAAAGQQGVTAQQQTRAEAAQQAQLPLQLTKELANEQVAEKV-QMM.-.-MSKNLKNLDIRLDPPELGRMQIRMTMNNDLA.NVHFTVTNPQARDIIEQTLPRLREMLAQQGMQLADSSVQQQS
Q9KQ73_VIBCH/480-623 RALAGSDERRAVSESGQEDLAQQIAAAAGQGTAQNQALNRAESQLVQTNATPVPLNKEMAADQLAERV-QMM.-.-MSKNLKNIDIRLDPPELGRMHIRMNMQGDGA.TVHFTVANQHAREALEQTMPRLREMLAQQGVQLGDTSVQQQS
Q9R9Y0_PSEPU/225-369 GSLLEDGLKDTKSASSDTRIDDFANRLASLTQAATAKTANAVPANANPLHQPLPMNQNAWAEGLVNRV-MYL.-.-SSQNLKSADIQLEPAELGRLDIRVNVAADQAtQVTFISGHAGVRDALDSQVHRLRELFAQQGLAQPDVNVADQS
Q9I3Q6_PSEAE/229-372 PAVASAASESLLESKAEPRGEPFAAKLNGLTQAMAQQALTNRPVNGTVPGQPVAMQQNGWSEAVVDRV-MWM.-.-SSQNLKSAEIQLDPAELGRLDVRIHMTADQT.QVTFASPNAGVRDALESQMHRLRDMFSQQGMNQLDVNVSDQS
Q9AES7_AERHY/180-323 LIASLQPLLGSEVPVEQEPVVPELKGAMGNLLSSPLSRPAEYQWAPAKLADNPAQWGQQLVDMLKDKV-ELQ.-.-VNQQIKQAHIRLDPPELGRLELTVRVDGDRL.NVQLNVSNPAVRDALIQSMERLRMSLAPHHAGGVEVNVGQGS
P74952_VIBPA/174-317 QALLNQPAQGQATTAPLNVQTSAPSAQAVSTATVAHAHTQGSEWAAVKVDTSAGKWGEQMMQVLHDRV-TLQ.-.-AQQSVQEAKIRLDPPDLGKLDLLVRVEGDRL.SVQINANTAATREALMQVSERLRTELQEQNFVHVDVNVGADQ
FLIK_SALTY/212-355 PALTPLVVAAAATSAKVEVDSPPAPVTHGAAMPTLSSATAQPLPVASAPVLSAPLGSHEWQQTFSQQV-MLF.-.-TRQGQQSAQLRLHPEELGQVHISLKLDDNQA.QLQMVSPHSHVRAALEAALPMLRTQLAESGIQLGQSSISSES
FLIK_ECOLI/181-324 GTPAQPLTPLVAEAQSKAEVISTPSPVTAAASPLITPHQTQPLPTVAAPVLSAPLGSHEWQQSLSQHI-SLF.-.-TRQGQQSAELRLHPQDLGEVQISLKVDDNQA.QIQMVSPHQHVRAALEAALPVLRTQLAESGIQLGQSNISGES
Q44769_BORBU/203-347 FSLNAIDGQNFVDRYKVKEISNDSLKGFVEEFANYNIKSSKDVGGFDFVSSLKPEWNLKINKNIVDKAKVVL.-.-KSNNTGEIKLVLKPKELGSIRINLNLDSNNNlLGKIVVDNQNVKMLFDQNMHSLNKMLGESGFN-ASLNLFLAG
FLIK_BUCAI/46-190 IILPLNIKKNKKIVFDSKNINKINPMISKRHSCKILSNKKEFIKSYIEPFMSSDTKNSIEWKKLISHKILLS.-.-ISNKYNQAKIHLKPESLGSIYVSISMKNNIA.TLKFISEHNEVKTFLDSYMPFLYNSLKKNGIKLKEFKISISS
Q9KA38_BACHD/208-351 SRTYRPFLLANDANEGRVQGLTLQHHGQELGQALNRTQQLVIHLGEQQPKEVQQQQFLRQFQQILQRG-NVV.-.-QLQNGTQMTIKLMPEHLGRLDIQLTQTNGAI.VARIMTSTTMARELVESQMNQLRYAFTQQQLNVERIEVVQQP
Q97H56_CLOAB/267-410 TNEQAKSGDSSENFLKNLISKDDNTESQFSKVTAFMNQFSSSAVEVQGDAKVMTANRVTFVEDMIKSV-KFM.-.-ENNNIKELTVKINPKELGEVIIKLTSEAGVM.KAELTTSNKDAYNLLNSNLNEMNKNLNEQNIKIQAFSVNVYN
FLIK_BACSU/233-381 TPLSQSSSSKNASDVSGSIQPVDSKSGLQMLFSGYRGIGGVQTLDLQQMSSDIPNAETKTVADQVINAWKQMkYtPFGRSTGSFTIRLNPEHLGFVTIKLTNENGMF.QSKIIASSQSAKELLEQHLPQLKQSLPNMAVQIDRFTLPVQS