EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02117 alignment
(10 sequences with 332 aa)


SRA10_CAEEL/6-335 ANSSKCATEDQMILQTSLLLRINVIIMTIVAIITFILTYKALFILKIRPIFHSSTKILLYTSLLFVNVHAVIFMVIQNTALIRSFTLSDKPCEIMRTTLECRFQNHVLIFGIAGVNFNQFGLTVDRLLATIIPQSYSHMGALPGVILSVLVVACSIAAPLIIAIGDPYDDIVPNCFFFPEHSAPRANIFLVTLSTLVITSIFLNFIIIYANKKLEKGCRTRFYVTQRYQKREALISTRIISYIAASQFLGLTLYSTMVLTLRLHK--SMIPISIYHNMVWWAYTVPFAAVSLPALLIYRINQVGSNRKRVINRITAKVETQEEHMKSLKELW
SRA9_CAEEL/1-330 MATIACASIIEQQRLRSSNFVIAQYIDLLCIVITFVTTYPAIQLVLNKSLFQWSTKMLILESLFFANLYQIFYGIEAITILYKHHFMTSDFCNIMQTESNCAPYLKVILGTTGGMIFAQTGLMIERTCATFLASYRKRKSEIIGFSITIIVFFCSSITGKLFIWDDPLDGMVLGCFILPKNSYKRYNTYFTVCTVLPLFNLGISILLKIYNTKLEY--SSRFEVSARFQKREVIDSTGTVCFLAFSLFILLFIYSVGVGALRHLLHENIISQEDFNLCVVWLYTIPFIAMLLPLLLIYRIRRTRSNRIEMLIEFTKQKQSQENHISQMKNMW
SRA8_CAEEL/1-328 MENLTCASSVEQDRFASLNFIISQSVDLITSFFTYMLSIIAIKMVLKQSIFETSTKILLFLNIFYANLYQIVYSIDVVVILYKHFFMQEEVCSLLILESSCAPFLETLIGTSSGMMYCQTGLLIERFCATFLKTYNGKKTIFVGSFIAIVVMISTTSTGKLVIWDDPLDDAVLACFIFPKKSKARSTIHFYISTVVSLFNLAASVALNKYNKTLEY--QVRFKICARFHKRQVIESTETICFLNFTQFVFMFIYSSGNSTLKSIR--DYIQPETYNFWVVWCYTVPFIALTFPLLLIYKVKSTRGIRAQKIVQISNTKQTQDEHINQMKVMW
SRA7_CAEEL/1-328 MSAPNCARKYDIARLSSLNFQISQYVYLSLISLTFIFSYFAVKIVHQKSIFQLSTKILLFHNLVSANLHQLLYLFSALRRLNLAYFYIDEPCVPLISEADCLPYLKVLVTGISGMIYGQTGLLLERGCATFIKDYDKKTSMFVGIAISIAILFLSLITGKIIIWDDPLQGYLLSCVSYPSQSVERSRLFASIYTFISSFNLVFSVLLRRYNKKLEY--STPFVVGPRFRKREVIDSTSTICFLTFVQFIFMFIYSFGIFTLKTIR--SMLTYRQYYFIVVWFYTIPFIAALFPILLVYRIRSSHVSRVTIIKTFTKTKQTQEEHIKQLKNVW
SRA4_CAEEL/1-328 MSLTKCASKLEIDRLISLNFRINQIIVLIPVFITFIFTYYAIKVVQKKSIFELSTKFLLIQNFFSANLHQVLYAIETIRRLHISLFETNQPCIPLKTEFECRLYLEVFVSGVAGMVYGQTGLLLERACATFIKNYEEKKSVRTGLAISVSVLCLSFITSRLIIWDDPLDGYQLTCISFPSDSVDRSSYFQSICTLLALFNLVTSILIWKYNKKFEY--STPFVVGPRFRKREVIDSTSTICFLTFVQFIFFLVYSLGFFIIKSIR--EIISYENYYLVAVWLYTPPYIAASFPILIFYRIRSSYANRVLIIKKFTNTKQTIEEHIQQMKNAW
SRA3_CAEEL/1-328 MSSQKCASHLEIARLESLNFKISQLIYFVLIITTLFFTFFALKVIQKKCIFQLSTKILLYQNLFSANIHQIFLGITIVERLNIAFFKLNDKCIPLRPETNCQLYLEMFIAGLSGMVYGQTGLLFERACATFIKKYEKRKSLATGIITSIIVLLLSGSTARIIIWDDPLSEYQLACTSWPSKSRDRSTMFFSICTFISLFNLVISLLIRRHNEKLEY--STPFVVGPRFRKREVIDSTSTICFLTFFQFIFMFIYSFGVFLLGTIR--EIIGYEQYYFWVVWVYTIPFIAASFPILLIYRIRYSNTNRIMIIKQFTSTKQTQEDHIKQMKNVW
SRA6_CAEEL/1-328 MSNLSCAAPDVLERLDSFNMKLSQFVDLLAIILAFFASYFAIKIVINQSFFELSTKILLLQNLFYTNLYQISYGIEAIGMLYRGFFMLSEPCSILQSETSCAPYFKVLMIGTSGMIFGQTGLLIERAFATFATTYKTKKSVYIGVCISLIVLVCSTSSGFIILWDDPLEGWTIGCFAVSKSVVPRFNLFSILSTVLTLFNLIVSIFIQRYNKRFEF--ETRFKVGARFQKQELIESTGAICFLALSQFLWMFMYSFGILILRIIR--EDILPSTFYFWIAWCYTMPFIALMFPVLLIYRIRKTRARRTEKMKGITTEKQTQDDHIKQINAMW
SRA2_CAEEL/1-328 MSNSSCADEDLIIRFDSLNQKAAQFVYLLAIILTFITTYFAVKILFTQSFFEISTKILLVQNLFYANLYQFFHGIEAVRMLYKSFFMINDPCNFMEPEIECVFYYKIILMGSSGMVYGQTGLLIERLCATFSKDYKKKQSAIKCAVISILVLICSSSTGRLIVWDDPIDKYNFACYIPPKESYIRANHYFTMCAVLSTINFCISTFILKYNKRCEY--QTRFKVGARFQKQELIESTKAICFLTVSQFVAVFLNSFGMIVLVYIQ--ESISHRIFNLLVVWLYAFPIVVLMFPVILVHQIRSSRWRRALKIKVIKNEKQTQDDHMKHMKNMW
SRA1_CAEEL/1-328 MSNITSASAAQIDHASSWNFRFAVFCSQLSIISTFILSVIAVKWIFTKSTFQTSTKIILVFNFVYANIHQFMYAIISLGMAYKGIFLLDETCEWLITEKDCLLYTEVLYVGISGMIYSQTGILIERAFATLYRNYTAKISRLVGIIISTFVLIMSIATYQIIISDDPLEGVVLSCFVPAQHSAQRANTFLFIALILTFVNLISSAAVMFYNKRLEY--SIRYKVRERFKKREAIYSTHTICVVCMAQFVTMLVYSSGVLILRCNM--SNILLTTFYKLITWVYTVQYNALLFPLILIFRIRATKLSRTKKIQDITSANQSQTEHYNQITSAW
SRA11_CAEEL/3-332 TNNPVCASDAHMEMYSSKLYTSALFLNLIIATTSMILTGFAIQKLFMESIINISTRMFLFCGLMCCSLHQTAYIVLRIQVIYQVFFKLSEPCNLYYPAIDCKYVTFSLVAGNTGMIFIQSAMTIDRIFATIFPKLWPKLKYWPGVVLSILMIACNYANVQIIFWGDPLTEYVPTCGQFPSKSVNRFQTFLAIALYMSIAHMVINVIILYINVLQDRQQSKSFNVNQRYQSREALKSSQAIFFLSMSQFFACLIYSVFTKVFLEFQ--LNLSPLQSGLVLALSYTTPYACIAIPSLIIFTFRFIKNQRLRNINELRSQTETGDECMRKIAKIW