EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02108 alignment
(2 sequences with 258 aa)


Q9Z6G6_VIBPA/1-257 MAGDRKRGFIRPDEDDALIEPQRWGLPDYGDSKEKKAKQTAFNYDPSWVPNFDEPEEEQALELTEEQIELIKQGAYQEGLYQGQEAGFKQGYDKGKEEGLQAGHAEGIELGKAEGVSAGQEFIQQQVEVFMN-LANQFAQPLELMNAQVEKQLVDMVLCLVKEVVHVEVQTNPQIILDTVKQSVEALPISGHPITLHLNPEDVAIIRSAYGEEDLDCRNWTLVSEPSLNRGDVQIEAGESSINYRMEERIKSVLHSFC
FLIH_ECOLI/1-220 MSDNLPWKTWTP---DDLAPPQAEFVP----IVEPEETIIEEA-EP-----------SLEQQLAQLQMQAHEQG-YQAGIAEGRQQGHKQGY--------QEGLAQGLEQGLAEAKSQ-----QAPIHARMQQLVSEFQTTLDALDSVIASRLMQMALEAARQVIGQTPTVDNSALIKQIQQLLQQEPLFSGKPQLRVHPDDLQRVDDMLG-ATLSLHGWRLRGDPTLHPGGCKVSADEG----DLDASVATRWQELC