EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02091 alignment
(9 sequences with 290 aa)


SYGA_SYNY3/5-288 FQAVIAKLNEFWAQQGCLIAQPFDTEKGAGTMNPHTFLRAIGPEPWSVAYVEPCRRPTDGRYGENPNRVQHYFQYQVLIKPSPDNIQEVYLDSLRALGIQPEDHDIRFVEDNWESPTLGAWGVGWEVWLDGMEVTQFTYFQQCGGIDCRPVSIEITYGLERLAMYLQNVEAIDQIQWNEK----LSYGDIFWQGEVEQCTYNFEASNPDLLFQLFALYEQEAGQLIERG..LALPSLEYVLKCSHAFNLLDARGVIAVTERTRYIGRIRNLAREVAHIYLQQREALGFPL
SYGA_BACSU/3-286 IQDMILTLQKHWSSQGCVLMQAYDVEKGAGTMSPYTFLRSIGPEPWKVAYVEPSRRPADGRYGENPNRLYQHHQFQVIIKPSPDNIQELYLDSLRALGIDPLEHDIRFVEDNWENPSLGCAGLGWEVWLDGMEITQFTYFQQVGGLECKPVSVEITYGIERLASYIQDKENVFDLEWTSG----FTVKDLFMMAEYEHSVYTFETSDVDMLFQLFSTYEKEAIKQMDNG..LVHPAYDYVLKCSHTFNLLDAKGAISVTERTGYIARVRNLARKVAKTYYEEREKLGFPM
SYGA_COXBU/9-296 FQQMILALQEYWASQGCVLLQPFDMEVGAGTFHPATFLRAIGPEPWRAAYVQPSRRPTDGRYGDNPNRTQHYYQFQVVLKPSPDDIQDIYLGSLKALGIDPLTHDIRFVEDNWEAPTLGSWGVGWEVWQDGMEITQFTYFQQIGGLECKPVTGEITYGLERLAMFLQGIDNMFDLVWTEGPNGRVTYGQIFQQNEVEMSAYNFEYANVEALFNFFDFYEKEASQLIEVH..LPLAAYEMVLKASHTFNLLDARQAISVTERQRFILRVRKLAQAVAEAYYSAREKLGFPM
SYGA_ECOLI/9-298 FQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRELGPEPMAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEnpLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREALGFPM
SYGA_MORCA/9-296 FQALILTLQNYWASRGCVVLQPYDMEVGAGTFHTATFLRALTPERWNTAYVQPSRRPTDGRYGDNPNRLQHYYQFQVVLKPNPANIQELYLGSLKAIGIDTLTHDVRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECFPVTGEITYGLERLAMYIQGVDSVYDLVWADGEFGRVTYGDVFHQNEVEQSAYNFEHADVAKLFELFDFYEEQADKLVAVN..LPLPAYEMVLKASHAFNLLDARGAISVTERQRFILRVRTLARKVAISYTEARAKLGFPL
SYGA_HELPY/4-291 FSSLLLKLQEYWKNQGCLVIQPYDIPAGAGTFHPATLLRSLDKKPWNVAYVAPSRRPTDGRYGENPNRLGSYYQFQVVIKPSPSNIQELYLKSLEVLGINLNEHDIRFVEDNWESPTLGAWGLGWEVWLDGMEVTQFTYFQQVGGIACSPIPVEITYGLERLAMYVQKVENILEIEWAKKNHDSVNYAQVHLESEYEFSKYHFETASVKRLLEMFKNAQAEALHCLENK..LPLPAYDFVMLCSHFFNILDARKAISVAERQNYILQIRDLAKGCALLYKEQEEEREERL
O23150_ARATH/73-356 FQQAIQRLQEYWASVGCAVMQPSNTEVGAGTMNPCTFLRVLGPEPWNVAYVEPSIRPDDSRYGENPNRLQRHTQFQVILKPDPGNSQQLFINSLSALGIDVTAHDIRFVEDNWESPVLGAWGLGWEIWMDGMEITQFTYFQQAGSLPLSPVSVEITYGLERIIMLLQEVDHFKKILYADGI----TYGELFLENEKEMSSYYLEHASVDRLQKHFDYFDEEARSLLALG..LPIPAYDQLLKTSHAFNILDARGFIGVTERARYFGRMRTLARQCAQLWLATRESLGHPL
SYG_CHLTR/8-291 LQTMMAAILNFWSEQGCIIHQGYDLEVGAGTFNPATFLQSLGPEPFRTAYIEPSRRPQDGRYGQHPNRLQKYHQLQVILKPVPENFLSLYLESLKVIGLNLVDHDIRFVHDDWENPTIGAWGLGWEVWLNGMEITQLTYFQAVGSKPLDAISGEITYGVERIAMYLQKKNSVYDVMWNDS----LTYGDITQYAEQAWSQYNFETANTTMWLKHFDDFSAEALATLDQG..LPLPAYDFVIKASHAFNMLDSRGVISVTERTRYIAKIRQLARAAADKYVAWRESLGFPL
SYG_CHLPN/8-291 LQSMIATILRFWSEQGCVIHQGYDLEVGAGTFNPATFLRALGPEPYKAAYVEPSRRPQDGRYGVHPNRLQNYHQLQVILKPVPENFLSLYTESLRAIGLDLRDHDIRFIHDDWENPTIGAWGLGWEVWLNGMEITQLTYFQAIGSKPLDTISGEITYGIERIAMYLQKKTSIYDVLWNDT----LTYGQITQASEKAWSEYNFDYANTEMWFKHFEDFAEEALRTLKNG..LSVPAYDFVIKASHAFNILDARGTISVTERTRYIARIRQLTRLVADSYVEWRASLNYPL