EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02090 alignment
(4 sequences with 147 aa)


Q57351_9ENTR/1-147 MHSLTRIKVLQRRCTVFHSQCESVLLRYQDEDRMLHAEEEAIVEQIAGLKLLLDTLRAENRQLSREEIYSLLRRQSIVRRQIRDLQLQITQIQEKRCELEKKTQEFQEKSKYWLRKEGNYQRWIVRQKRFYIQREIQQEEAESEEII
Q54058_9ENTR/1-147 MHSLSRIKVLQRRCTVFHSQCESILLRYQDEDRRLQDEEEAIGEQIAGLKLLLDTLRAENRQLSREEIYSLLRKQSIVRRQIKDLELQITQIQEKRYELEKKREEFQEKSKYWLRKEGNYQRWIIRQKRLYIQREIQQEEAESEEII
Q54043_SALTI/1-147 MHSLTRIKVLQRRCTVFHSQCESILLRYQDEDRGLQAEEEAILEQIAGLKLLLDTLRAENRQLSREEIYTLLRKQSIVRRQIKDLELQIIQIQEKRSELEKKREEFQKKSKYWLRKEGNYQRWIIRQKRHYIQREIQQEEAESEEII
Q54049_9ENTR/1-147 MHSLTRIKVLQRRCTVFHSQCESILLRYQDEDRRLQAEEEAIVEQIAGLKLLLDTLRAEKRLLSREEIYSLLRKQSIIRRQIKDLELQTTQIQEKRNELEKKREEFQEKSKYWLRKEGNYQRWITRQKRLYIQREIQQEEAESEEII