EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02075 alignment
(9 sequences with 152 aa)


RUVC_MYCLE/3-152 VMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVSDVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDVHFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTP--ADAADALALAICH
RUVC_MYCTU/3-152 VMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTHHPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDVHFHTPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTP--ADAADALALAICH
RUVC_ECOLI/3-149 ILGIDPGSRVTGYGVIRQ-VGRQLSYLGSGCIRTKVD-DLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQ---ADAADALAIAITH
RUVC_HAEIN/4-150 ILGIDPGSRVTGYGVIRQ-TGKHLEYLGSGAIRTQVE-DLPTRLKRIYAGVTEIITQFQPNMFAIEQVFMAKNADSALKLGQARGTAIVAAVNNDLPVFEYAARLVKQTVVGIGSADKVQVQEMVTRILKLSDKPQ---ADAADALAIAITH
RUVC_PSEAE/4-150 ILGIDPGSRITGFGVVRE-TARGCEYVASGCIRTGNG-PLHERLHVVFRSVREVIRTHGPTALSIEQVFMARNADSALKLGQARGAAIVAAMEEGLSVAEYTASQVKQAVVGTGGADKQQVQMMVMHLLKLTQKPQ---IDASDALAIALCH
RUVC_TREPA/19-167 IVGIDPGLESTGYGVIEA-GGGSLRCLTYGVIVTQSNQPSAARLRHIFDTLQQVISIYQPQYCAVETIYFAKNVTSALCVAQARGVVLLAMAQQHISVAEYAPNAIKKAITGIAQAEKRQVQHLVKILLNLKDIPHP--DHAADALAVAVTH
RUVC_CHLPN/5-156 IIGVDPGTIVAGYAIIAVEQRYQLRPYSYGAIRLSSDMPLPMRYKTLFEQLSGVLDDTQPNAMVLETQFVNKNPQSTMKLAMARGIVLLAAAQRDILIFEYAPNVAKKAVVGKGHASKRQVQVMVSKILNVPEVLHPSNEDIADAFALAICH
RUVC_HELPY/3-150 ILGIDPGSRKCGYAIISH-ASNKLSLITAGFINITTT-RLQEQILDLIEALDCLLDRYEVNEVAIEDIFFGYNPKSVIKLAQFRGALSLKILERIGNFSEYTPLQVKKALTGNGKAAKEQVAFMVKRLLNITSEIKP--LDISDAIAVAITH
RUVC_HELPJ/3-150 ILGIDPGSRKCGYAIISH-ASNKLSLITAGFINITTT-RLQEQILDLIEALDCLLDRYEVNEVAIEDIFFGYNPKSVIKLAQFRGALSLKILERIGNFSEYTPLQVKKALTGNGKAAKEQVAFMVKRLLNITSEIKP--LDISDAIAVAITH