EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02074 alignment
(3 sequences with 508 aa)


O58210_PYRHO/20-514 VFRNDTIKEILQKYRRIWALGHAQSVLGWDLEVNMPKEGILERSVAQGELSVLSQELLLKPEFVELVEKAKGI---EDLNEYERGVVRVLDRQIRIMKSFPPEFLKEVSETTSKATKAWEEAKAKDDFSKFEPWLDKIISLAKR---AAEYLG-YEEEP-----YDALLDLYEEGLRTRDVVKMFDVLEKELRPLLEKILEEDKVPREHPLEKEKYEREWMEKVNLWVLEKFGYPLGTRARLDVSAHPFTTEFGIRDVRITTRYEGFDFRRALLSTIHEFGHALYELQQDERFMFTPIAGGVSLGIHESQSRFWENIIGRSKEFVEFIYPVLKENL-PFMEKYTQEDVYLYFNMVRPDFIRTEADVVTYNFHVLLRFKLERMMVSEDVKAKDLPEMWNDEMERLLGIRPKTYREGILQDIHWAHGSIGYFPTYSIGTILSAQLYYHIKKDIPDFEEKVAKGEFEPIKSWLREKIHRWGSIYPPKELLKKAIGEDVNAEYFVRWIKERY
YPWA_BACSU/1-495 MEIHTYEKEFFDLLKRISHYSEAVALMHWDSRTGAPKNGSEDRAESIGQLSTDIFNIQTSDRMKELIDVLYER--FDDLSEDTKKAVELAKKEYEENKKIPEAEYKEYVILCSKAETAWEEAKGKSDFSLFSPYLEQLIEFNKR---FITYWG-YQEHP-----YDALLDLFEPGVTVKVLDQLFAELKEAIIPLVKQVTASGNKPDTSFITK-AFPKEKQKELSLYFLQELGYDFDG-GRLDETVHPFATTLNRGDVRVTTRYDEKDFRTAIFGTIHECGHAIYEQNIDEALSGTNLSDGASMGIHESQSLFYENFIGRNKHFWTPYYKKIQEASPVQFKDISLDDFVRAINESKPSFIRVEADELTYPLHIIIRYEIEKAIFSNEVSVEDLPSLWNQKYQDYLGITPQTDAEGILQDVHWAGGDFGYFPSYALGYMYAAQLKQKMLEDLPEFDALLERGEFHPIKQWLTEKVHIHGKRKKPLDIIKDATGEELNVRYLIDYLSNKY
CTAQ_THEAQ/1-505 MTPEAAYQNLLEFQRETAYLGSLGALAAWDQRTMIPRKGHGHRARQMAALARLLHERATDPRIGEWLEKVEGSSLVEDPLSDAAVNVRAWRRAYERARAIPERLAVELAQARSEGETAWEALRPRDDWQGFLPYLKRLFALAKEEAEILMAVGPDPLDPPYGELYDALLDGYEPGARARDLEPLFRELSSGLKGLLDRILGSGRRPDVGVLHR-HYPKEAQRAFALELLQACGYDLEA-GRLDPTAHPFEIAIGPGDVRITTRYYEDFFNAGIFGTLHEMGHALYEQGLPEAHWGTPRGEAASLGVHESQSRTWENLVGRSLGFWERFFPRAKEVF-SSLADVRLEDFHFAVNAVEPSLIRVEADEVTYNLHILVRLELELALFRGELFLEDLPEAWREKYRAYLGVAPRDYKDGVMQDVHWSGGMFGYFPTYTLGNLYAAQFFAKAQEELGPLEPLFARGEFTPFLDWTRRKIHAEGSRFRPRALVERVTGSPPGAQAFLRYLEAKY