EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02068 alignment
(4 sequences with 80 aa)


Q9ZTM1_PETHY/10-88 ICDERCGCPSPCPGGVACRCASGGAATAGGGDMEHKKCPCGEHCGCNPCTCPKSEGTTAGSGK-AHCKCGPGCTCVQCAS
EC1_ARATH/12-84 GCNDSCGCPSPCPGGNSCRCRMR---EASAGDQGHMVCPCGEHCGCNPCNCPKTQTQTSAKG----CTCGEGCTCASCAT
EC1_WHEAT/1-77 GCDDKCGCAVPCPGGTGCRCTSAR---SGAAAGEHTTCGCGEHCGCNPCACGREGTPSGRANRRANCSCGAACNCASCGS
EC_MAIZE/1-75 GCDDKCGCAVPCPGGKDCRCTSG-----SGGQREHTTCGCGEHCECSPCTCGRATMPSGRENRRANCSCGASCNCASCAS