EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02059 alignment
(5 sequences with 121 aa)


IL3_BOVIN/18-132 APQAKGLPVVTSRTP-YSMLMKEIMDDLK--KITPSPEGSLNSDEKNFLTKESLLQANLKVFMTFATDTFGSD-SKIMKNLKEFQPVLPTAT--PTEDPIFIENKNLGDFRMKLEEYLVII
IL3_PANTR/20-137 APMTQTTSLKTSWVN-CSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFN-RAVKSLQNA-SAIESILKNLLPCLPLATAAPTRHPIRIKDGDWNEFRRKLTFYLKTL
IL3_SAGOE/19-136 AAPTQTTSLKATQVN-CSNLREEIVTLLNQPPLPSSNFNNLNREDQRILMKPNLRRPNLEAFQ-KAVKSLQNA-TAIESSLKDLPLCLPMATNASMQHPIRIKDGDWNDFRMKLKFYLKTL
P97688_RAT/27-141 ISDRGSDAHHLLRTLDCRTIALEILVKLPY----PQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLD--DFKKKLRFYVIHL
IL3_MOUSE/27-138 ASISGRDTHRLTRTLNCSSIVKEIIGKLP-------EPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLD--DFRKKLRFYMVHL