EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02046 alignment
(5 sequences with 113 aa)


COX13_YEAST/20-129 PAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHI---EHDD
COX13_SCHPO/26-130 LSFRAYSNEAKVNWLEEVQAEEEHAKRSSEFWKKVTYYIGGPALILASANAYYIYCKHQEHAKH-----VEDTDPGYSFENLRFKKYPWGDGSKTLFWNDKVNHLK---KDDE
COX6A_CAEEL/23-124 SFYGSNNVEGFK---ESYVTPLKQAHNASETWKKIFFIASIPCLALTMYA---AFKDHKKHMSH-----ERPEHVEYAFLNVRNKPFPWSDGNHSLFHNKAEQFVPGVGFEAD
CX6A1_HUMAN/24-109 MSSGAHGEEGS-----------------ARMWKTLTFFVALPGVAVSMLN---VYLKSHHGE-H-----ERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLP-TGYEDE
CX6A1_CYPCA/16-100 AASQGSHEGG------------------ARTWKILSFVLALPGVGVCMAN---AYMKMQAHS-H-----DPPEFVPYPHLRIRTKPWPWGDGNHSLFHNAHTNALP-TGYEGP