EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02041 alignment
(4 sequences with 170 aa)


ABP1_MAIZE/36-201 AESSCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMG-SSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKD---EL
P93271_MALDO/24-193 ASKCSLKGLPIVRNISELPQDNYGRGGLAHTTVAGSLLHGLKEVEVWLQTFAPGSGTPIHRHSCEEVFVVLKGSGTLYLAPSSHGKFPGKPQEFSIFANSTFHIPVNDVHQVRNTNEHEDLQALVTVSRPPVKVFMYQDWFMPHTAAKLRYPYYWDEECLDVEPPPKDEL
ABP1_TOBAC/19-187 ASQCSINGLPLVRNISELPQENYGRSGLSHTTIAGSVLHGMKEIEVWLQTFAPGSRTPIHRHSCEEIFVVLKGQGILYLTPSSHSKYPGNPQEFHIFPNSTFHIPVNDVHQVWNTGEHEDLQVLVVISRPPVKVFMYDDWSMPHTAAKLKFPYYWDEECYQTTSW-KDEL
ABP1_ARATH/33-198 GAPCPINGLPIVRNISDLPQDNYGRPGLSHMTVAGSVLHGMKEVEIWLQTFAPGSETPIHRHSCEEVFVVLKGSGTLYLA-ETHGNFPGKPIEFPIFANSTIHIPINDAHQVKNTG-HEDLQVLVIISRPPIKIFIYEDWFMPHTAARLKFPYYWDEQCIQESQK--DEL