EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02040 alignment
(4 sequences with 424 aa)


O68021_PSEAE/3-423 IAFAIFLFTLVLVIWQPRGLGIGWSASIGALLALALGSVAPGDIPTVWNIVWNATATFIAVIVISLLLDEAGFFEWAALHVALGWR--RTRRLFAFCVLLGAAVSALFANDGAALILTPIVMSMLLALRFSPAATLAFVMAAGFIADSASLPLVVSNLVNIVSADYFGLGFGEYAAVMLPVNLVSVATSLLVLFLYFRRDLPPVYALEQLKPPRAAIRDRATFVVGGWMLLVLLAGLFALEPLGVPVSAVAAACAALLLAVAGRGRVIST-RRVREAPWQIVVFSLGMYLVVYGLKNAGLTDLLAQLLNRMTEHGVWAAALGTGLLSAALSSVMNNMPSMLLGALSIQASDTAGPVREAMIYANVIGCDLGPKITPIGSLATLLWLHVLARKGMRITWGYYFRVGALLTLPVLLATLSALALRL
ARB2_ECOLI/3-425 LAGAIFVLTIVLVIWQPKGLGIGWSATLGAVLALISGVVHIGDIPVVWNIVWNATATFIAVIIISLLLDESGFFEWAALHVSR-WGNGRGRLLFTYIVLLGAAVAALFANDGAALILTPIVIAMLLALGFSKGTTLAFVMAAGFIADTASLPLIVSNLVNIVSADFFGLGFTEYASVMVPVDIAAIIATLVMLHLFFRKDIPPTYDLALLKAPAKAIKDLATFRTGWIVLILLLVGFFVLEPLGIPVSAIAAVGAVILFAVANRGHAINTGKVLRGAPWQIVIFSLGMYLVVYGLRNAGLTEYLSGVLNVLADKGLWAATFGTGFLTAFLSSIMNNMPTVLVGALSIDGSTATGVIKEAMIFANVIGCDLGPKITPIGSLATLLWLHVLSQKNMTITWGYYFRTGIVMTLPVLFVTLAALALRL
P96678_BACSU/6-428 LAVFIFLLTLVLVIWQPKNLSIGWSACGGAVLALIAGVVNFHDVLTVTGIVWNATLAFVAIILISLILDNIGFFEWAALHMAK-AAKGYGVRMFVYVSLLGAIVAALFANDGAALILTPIVLAMVRALHFNEKLVFPFIIASGFIADTTSLPFVVSNLVNIVSADYFHITFIDYASRMVVPYLFSLLASIIVLYLFFRKSIPKRYDLTEVKKPVEAIKDQNMFRLSWYILGLLLIGYFASEFFSIPVSVVAGSIAIIFLIAAQKSPAVHTKKVVKEAPWAIVFFSIGMYVVVYGVRNAGLTDVLSDVIQAAADQGLFAGTIGMGFIAAILSSIMNNLPTVMIDALAIAGTDTHGMMREALIYANVIGSDLGPKITPIGSLATLLWLHVLSHKGMKISWGTYFKTGIILTIPTLLITLVGLYIWL
ARSB_STAXY/4-426 LAIVIFLLTLIFVIWQPKGLDIGITALIGAVVAIITGVVSFSDVLEVTGIVWNATLTFVAVILISLILDEIGFFEWSAIHMVK-ASNGNGLKMFVFIMLLGAIVAAFFANDGAALILTPIVLAMVRNLGFNKKVIFPFIIASGFIADTTSLPLIVSNLVNIVSADYFDIGFIEYFSRMIIPNIFSLIASILVLWLYFRKSIPKTFNTENLSDPKNVIKDPKLFKLSWIVLAILLVGYLVSEFIQIPVSIIAGIIALIFVILARKSKAVHTKQVIKGAPWNIVVFSIGMYLVVFGLKNVGITTILGDILTNISSYGLFSSIMGMGFIAAFLSSIMNNMPTVLIDAIAIGQSSATGILKEGMVYANVIGSDLGPKITPIGSLATLLWLHVLTQKGVKISWGTYFKTGIIITIPVLFVTLLGLYLTL