EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02021 alignment
(8 sequences with 99 aa)


Y1656_HAEIN/11-105 SFEHQARLFLESKGLIFIAANQNF-KCGELDLIMND--KETIVFVEVRQRSHSAYGSA-IESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFG
YRAN_ECOLI/22-115 AWEAQARRWLEGKGLRFIAANVNE-RGGEIDLIMRE--GRTTIFVEVRYRRSALYGGA-AASVTRSKQHKLLQTARLWLARHNGSFDTVDCRFDVVAF-
Y189_SYNY3/7-103 AGESLVAAWLEQQGGKILQQRWRS-PWGEIDLITHFPDTKIIAFVEVKTRSGGNWDQGGLLAVNARKQEKIWQTANHFLASQP-QWSDWNCRFDVMIVF
Y913_TREPA/11-104 FGEAYAARWLATRGYIIITRNWRR-ATGEIDIIAQQ--DDTIVFVEVKTLRCTSYADL-AIIVGKRKQKRICETAKHFLASAR-EYNHMCARFDVIVLR
Y5602_STRCO/20-114 YGETLAARRLTGAGMTVLERNWRCGRTGEIDIVARD-GDVLVVC-EVKTRRGGAFEHP-MAAVTPDKAERLRRLAERWIQTHGG-APPGGVRIDLVGVL
Y2922_MYCBO/15-109 MGEALAVDYLTSMGLRILNRNWRC-RYGELDVIACDAATRTVVFVEVKTRTGDGYGGL-AHAVTERKVRRLRRLAGLWLADQE--ERWAAVRIDVIGVR
Y041_AQUAE/5-89 EYEDLAARYLKSKGYQILGRNLRS-PYGEIDILAEF----EGRKVIVEVKGSETFFP--AEKVTPHKLSKIIRTAYEVLGEEP-------FSIEVVVVY
Y823_HELPY/14-102 KAEEEACGFLKSLGFEMVERNFFS-QFGEIDIIALK----KGVLHFIEVKSGENFDP--IYAITPSKLKKMIKTIRCYLSQKD--P-NSDFCIDALIVK