EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01986 alignment
(4 sequences with 99 aa)


O26737_METTH/21-115 IGSLGTVRFPPGFYVYVGSGFS---SLEARIKRHLSSEKRRRWHIDHFLDGAEVECVLYTTDKRRLECAVSEKLHGEKS-VRGFGCSDCSCKSHLHHFK
O29864_ARCFU/1-91 MGALGVIAFRRGYYYYVGSANS---GVH-RVKRHFSIKKKKRWHID-YIS-AKMEVVGAILSKE-PECGLAQRFESFER-IRGFGCSDCDCESHLFYSP
Y613_METJA/247-343 KFGKTERFFKKGYYFYIGSAFGNSMNLKNRIERHLKDDKKMHWHIDYLLKYGKIEEIYIT--NERVECEVANEFIKKFDFVENFGCSDCKCKSHLFYLK
O58363_PYRHO/19-114 RTKAREFELTRGYYVYVGSGMN---SLEKRVLRHFSRRKKLHWHIDYLLEKAILLRAYLIPSNERLEERISLEIGKYGTPVEGFGSSDLKVKSNLYRFN