EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01956 alignment
(4 sequences with 214 aa)


O26136_METTH/2-185 VLEIVYGALNAVFGPFIAMDP-----------NPQNPILTVFLISAIVAFVITLANKLLVDQERLEELKVEMQEFQQEMMEARKKNDMAALEEIQKKQMEFMDKQREMMTMSFK-PMIVTFIPIILVFYWM------G---QE--PHIVNTLVILPQIAYYVLLVPLWH----MFY-GMPPNAPSYAIG--WLGWYILCSFAMSQIFRKFMGLK
Y480_METJA/5-198 IFDIYYKTLDAIFMPIIKV---------------LHPALAILIIAIIVSLIINIATKLLVDQKRVAELKKEIQEFQVKFKKMSKNPEM--MEKLQEEQQRIMQLNAELMKMSFR-PMIYTWVPIILIFIYLRHVYGFGGVYQELNPGWNGVVVYLPIILSKILFIDFWHWLGSIFYKGGFKIVSNTALG--WLGWYILCSFATSTVLRKILGIK
O59444_PYRHO/1-175 MLEGIYLALDKMFGPMLRN---------------THPMWVVTVSGVILGAFFVLLNYFLVDQEKMKRLQKMAKELQEEFKKARESGDEKKLRKLQQKQLELLRLQNELMKDAFLKPMLITWPIIIIFWGWLKR----W--------YFETAIVKYPFN---FFLFDIFH----KMY---HSALKPDELG--YFGWYFLTSYVVGTILRKVLDMA
O28378_ARCFU/10-220 MVLGALFFIGILFSREFRLELGQIVESVLFFLSPYPFHVVILIMSILTGIYSNLIQKFTIDYKRMKEIQKILREYQKEYIEATKQNNKFKLKQLEQKKNEIQQIQSEMMSMQFK-PMFYTFVVTIPIFAWLWEKASASYELVTGATNYGNLTSELPEVFLQTLKPELYT--VVAPFAGQIHVVTPVLIFPWWLFWYLLCSITFGQIIKKVLRVG