EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01920 alignment
(62 sequences with 111 aa)


PFDB_AERPE/10-115 EAKYTKYLKLRETLSVVMREKATVEAGLAEVESVLKELEGLPED...AELYRLTGFVLVKK.SKNEVVEDLNKRKEDLELKLKVLKSQEEHLKKELERIESELRR.LLQGG
PFDB_SULSO/10-115 QAQLAKFQQLKDQLDRLLLEKSTIENELREINKVLEELSVLNAD...ATIYKIVGNLLVKS.DKTSVEKELNDRKELLELRSRTYQKQESILRKQLEDLQAKIND.MLSKY
PFDB_SULTO/10-115 QTQLVKLQQLQDQLNRLLTEKNVIDSELREVNKILQELSQLPAG...TTVYKIVGNLLVKT.DKETVQKELDDRKEILELRSRTYQKQENLLRTQLEDLQKKVNE.LLAKY
PFDB_PYRAE/9-114 QDLVNRFNQAQAQLQNVLLRKQQYEAELKEVEKAISEIERLPQD...AKIFKNVGNFLVPQ.SRDVALQELRDRKELLELHVKTLTRQESMLREQLDKLREEINK.ELAKL
Q6M0M5_METMP/8-112 QNQLMQFQQLQQQLQMIMYQKQQFETQLKEMEKAIEEMEKSDSE...-EVFKMAGGILVKR.NKAEVKEELSEKIETLQLRVTTFEKQEEKMQKRYTELQESLQK.VMGQG
PFDB_METJA/8-112 QAQLMQLQQLQQQLQMILMQKQSVETELKECKKALEELEKSSSD...-EVYKLVGGLFVKR.KKEDVKKELEEKVETLELRVKTLEKQEEKLQSRLKELQEKIQK.MIPTA
PFDB_METKA/6-111 EQQVAQLQQLQQQLSSIVAQKQQLELQLREIERALKELDEIEED...TKVYKTVGGLLIEA.DRDEVKEELEDRKETLELRVKTLEKQEKRLQQQIENLQKRLQK.ALQQA
PFDB_METTH/8-113 QHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADD...AEVYKSSGNILIRV.AKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQE.AMKGA
PFDB_ARCFU/9-114 QNLVAQLQQLQQQLQAVITQRAQVEALLRDTEQALEELQKVDDE...TPVYKAVGNILVKE.KKEDVIKELTEKKETYEIRIKTLQRQEEKLRERFAETQQKLQN.LLSPQ
PFDB_METMA/10-115 QNQIAQLQQVQQQVQALSMQKSQIEAMQKESKMALEELERLADD...AVIYRSVGELVIKT.TKEESVSKLKDREETLSLRLQSISRQEERLTARFKQLQEQIQQ.ALGPR
PFDB_PYRHO/9-114 QAMLGQLDTYQQQLQLVIQQKQKVQADLNEAKKALEEIETLPDD...AQIYKTVGTLIVKT.TKEKAVQELKEKIETLEVRLNALNRQEQKINEKVKELTQKIQA.ALRPP
PFDB_HALN1/10-115 QEKLEQLQDLQEKAQNVATQKQQAEQQLSEAETALDALGDIEES...TTMYREVGELLVET.EYDNAHDDLDEKVSDLEVRVETLQKQEDRVQEQFESLQEELQD.MLGGA
Q6L0A9_PICTO/11-117 QNQIKQAQDIEAQIESIASQRYQLDVLIRELDKTIKELKSISEG...TPVYKSVGPVMYLVeDKNKLINDLEEQKELSQMRSKTLENQQKSLEQKYREVQESLQK.KYQEA
PFDB_THEVO/11-117 QNQLKQAQELEENIEKIATQRYQLDLSLKEIEKTLQELNKIDDK...TPVYRSIGSILYKVdDKKKLIDELEEQLELTKIRINTLDKQQKSLEEKYKELQAAIRE.RYNQD
Q7SX94_BRARE/10-115 QAELEKYQQLQKDVSKSMSARQKLEAQLTENNIVKEELALLDSQ...NTVYKLIGPVLVKQ.DLDEAKATVGKRLEYINGEIQRYETLLKEMERKSEQHREVLSS.LQQEY
PFD6_HUMAN/10-115 QGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGS...NVVFKLLGPVLVKQ.ELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQ.LQQEF
Q6XHQ2_DROYA/13-118 QTEVESYQNLQKSCVKMVKQRALLESQLNENKCVLDELNLLGPD...NKVYKLFGPVLVKQ.ELEESRQNVGKRIEYISKELKSSTDTLESMEKDMQKHQETMAK.YQQQW
Q7Q034_ANOGA/13-118 EAELKNFKDTQREFSKLVQTQQQLDGQYFENKSILEELQMLKPT...NTVYKLYGPVLVKQ.DLEESKQNVGKRIEYITKELKRCGENITQLEAKQDKYRANLQK.LQMQY
Q6K3S8_ORYSA/22-128 ESQANALSKIQKDISKNHQVRKQYTIQVGENELVLKELELVNDE...ANVYKLIGPVLVKQ.DLAEAKANVKKRIEYISAELKRMDRALKDLEEKQNSKKESISHdRLMSV
Q8GYJ1_ARATH/14-119 ENKANDLGKIQKDIGKNHQLRKKYTIQLGENELVLKELDLLEED...ANVYKLIGPVLVKQ.DLAEANANVRKRIEYISAELKRLDVILQDMEEKQNNKRETIMK.LQQRL
PFD6_CAEEL/8-113 EEEVNKLRTLEKDREKYFTSRQEMEMRLTESKNVKAELDLMESD...SKVYKLIGAVLVRQ.DLEEARSTVEKRLEFIDSETKRVEASISDISKKCTEQRDKVMN.MQKSF
Q7S0H5_NEUCR/10-115 QALSDEYQNLNKELQETVLARQKLEAQKQENVSVQNEFEKLKDD...EQIFKLVGPVLLKQ.DKMDAENTVKGRLEFISKEITRLEGVIKETQGKIEKKRTEIIQ.VQTSA
PFD6_SCHPO/2-107 EELAKKYQNLQTELSTYVESLKKLETQLQENTTVLNELEKVAPD...SNIYKQIGPTLVKQ.SHEEAKTNVKTRLDFINKEIARLENQTKISQEEFSKVKGAIIQ.AQAAA
PFD6_YEAST/2-107 SELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEED...TPVYKLTGNVLLPV.EQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIK.LNNTA
Q9N6L6_LEIMA/16-121 RPILKELQEMGDKKGKLIEARRQLGGQKNENELVRDELNRLEPD...ATVYKLIGPALVPQ.DQSDAKTIIGNRLDYINGEIKRSDTSIAELDRKEAELQKKAQE.LYRKM
Q8I3Y6_PLAF7/7-105 SEIIKDISALKTSCEKLNSQLDELITQKVENEMLLEEVKVLEDD...SVLHKLVGLVLVKE.EKSKCYDTISRRLQYITGEIENRKKVITNSEEKLRK-------.LFSDK
PFD2_DROME/13-118 EAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPE...RKCFRQIGGVLCER.TVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNI.KIRGE
Q7Q629_ANOGA/13-118 EEIAAEFQQLRNQQRNLVNNLNTIEMDLKEHKTVIDTLKTVESS...RKCFRLIGGVLVEQ.TVEVVLPQLELNKAQLEKLIEEGKEQITKKGLEINQFKDEHNI.KVRGQ
PFD2_MOUSE/24-129 EQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDET...RKCYRMVGGVLVER.TVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFREKHNI.RLMGE
PFD2_ARATH/17-122 QAVLNMYEGKRSELSQIYSNITDLEMQVSEHSLVINAIQPLDQS...RKCFRMIGGVLVER.TIKEVLPAVQRNKDGLEEVVRKLYETLEKKKKDLTEFEAKYKI.RITKQ
PFD2_CAEEL/18-123 RKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEPD...QKCFRLISDTLVEY.TVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNI.RLLTE
Q9NEG6_LEIMA/15-120 EQIVQQYNRMRQEQSAIMSRIAELENESHEHDLVATELRPLNKD...RCCHRLVGGALVEL.TVGEVLPDIEENLAAIREALVQLNKGLMEKEKQMDEFMTKHKL.NRPGA
Q7SF61_NEUCR/12-117 QDLQLQYTTYKNTLQQIAQKIGDVEQEAEEHKLVLETLDPLPAD...RKCFRMINGVLVER.TVEDVIPALKTNAEGLKKVLNDLVKQYQNKQEELDKWKKKNNV.QVVQS
PFD2_SCHPO/9-114 QILQTQYNSYKSRLQQIAQKIVDLETDADEHKLVMDTLNSMDNN...RRCFRMIHGVLVER.TVGTVVPILKTTQEGIQTAMNGLLDQYKQLEAEFQKFQKDNKI.QVVRQ
Q75AC1_ASHGO/19-124 SVLQLKYNEYKQTLEELQTKIIELGNDKEEHEVVLTTLNGVDKA...RKCYRMVGGALVET.DVQTTIPILQTKKENLSSTISALKGELVKVAEEFEKWKKDNKI.QVLKQ
PFD2_YEAST/18-123 IVFQAKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPT...RKCYRMIGGALVES.DVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKI.QVVKN
Q8ILS7_PLAF7/18-118 SKLT--YEQIEKDRVQLVSKIEELYQDVVEHKLVLEALENVPSD...RRCYRMVGEVLVER.TVGEIKPALMDHKNKVEQVIAECQKQLDQKNNEISNFIKSAK-.--AGN
Q90634_CHICK/80-171 NVLQAQLQRLQEDIENLREEKES------EISSTRNELVSAQNE...---------ILSLQqVAEKAASERDTDISALQEELQTVRAELERWRKDASDYEKEIVS.LQASF
Q8VC86_MOUSE/177-268 QVLQVQLQKLHMDMENLQEEKDT------EISSTRDKLLSAQDE...---------ILLLRqAAAEAVSERDTDFVSLQEELKKVRAELEGWRKAASEYENEIRS.LQSSF
Q8NCW9_HUMAN/19-110 QVLQAQLQRLHIDTENLREEKDS------EITSTRDELLSARDE...---------ILLLHqAAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITS.LQNSF
Q9VMH8_DROME/13-118 TEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGTSSLADD...TRVYQSVGRMFLLT.DVQNMREDLKARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRE.LVQQR
Q7Q0Q5_ANOGA/3-108 TEMQVNKIESTKKIRLLDMKMDSLKLSKQRIEVTNRHISNLAPE...TRVYASVGRMYVLN.DVPTLTEQLKTTHASYEEIITQCEKNKDFLIKNLKEQEESLRE.LVQQK
PFD1_CAEEL/11-116 RDLQFKTNETRMRIVQGEQNKKVNYQKMRISESTKKNLVDLDEN...LKYYRSVGRMFLLT.DKPAEISRHEAEAKQSKEKIEAIEKQKDYLEKGLVEAETNLRE.LIQSR
Q94AF7_ARATH/11-116 MEIQASMIELTGKLKQVQNQMRNKEGDRKRAFLTLEELRPLPEE...TNTYKSIGRTFVLE.PKTVLEGEQEQKLKDSEAAVASLQTSKEYLEKQVAEVENNLRE.LLQQE
PFD1_HUMAN/14-119 TELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDE...TNMYEGVGRMFILQ.SKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIRE.MLMAR
Q9P3P3_NEUCR/13-118 REIEAQSIAAQQQIGLVRTQQASKQREMRLAQLTRNELATLPET...TAVYEGVGKMFVSV.PVPALKDRLSTEMKEMETEVENLGKRLHYLETTAKNSQEHIEK.MLKGG
Q757Z9_ASHGO/9-112 QEIAAGLRNSKGQLELVTAQLAQLQRQKKLAHVTAKELGSYPVD...-QVWRSCGKMFLLD.SKTDYTQQLDADAKTIEEQIKALEVKRHYLETTVENSIEALKK.-AVQR
PFD1_SCHPO/6-111 SQIQEKAVDSQQQLRTIMVQIAAKERALKISELAKKELEDVGED...KAVYTSLGKMFMKS.DLASVRTHLDAEMASLREDIEALQKKQTYHETTASNAEQHLQK.IKESI
PFD4_SCHPO/11-119 QRNLNEFSVLHSRKAIQELDIKNLKTQIEDIVDAKNECELLDEDdgdDIPALKVGDAFFQV.SLPVLLDQLEQSEESLEKQVDVLRSSMEKDETRIQELKSMLYS.KFHDQ
PFD4_HUMAN/20-126 QQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDD..cLMIPYQIGDVFISH.SQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYA.KFGSN
Q8MRY9_DROME/26-131 QQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDED...EDIPFLVGEVFLSH.KLEKTQDMLKETKEQVLKEIAVVEAKAKVIKAEMDELKAHLYQ.RFGSN
Q7QIM0_ANOGA/9-114 QMKINKFANYNAKVEDLKEELRIKQNELKNLEEAGDEIELLDDD...VQIPFLMGDVFLSH.DQAKTLELLAEAKERKKKEINGIQQISRDLQQKMSDLKGYLYG.RFGSN
Q754N3_ASHGO/35-140 QQRINEFSKLVMRKDALEAELRSQRQEKEYVDDAALEIELVDED...AALQYKIGDVFVLM.RQEEVAAQLERDQAAADARIRQLEEEEEHVDARMRALKQVLYA.KFGDS
PFD4_YEAST/19-124 QQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELIDED...EPVQYKVGDLFIFM.KQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYA.KFGDN
Q6UNN7_9HYPO/29-134 QDKINKFSRLHQRELALEEQLKGKSKEKEELDDLSTELELADED...EKIQYKIGDAFFHI.PLEQAQEMLETATTRIEDETSELEEKMSTVREEMQQLKVELYA.RFGRQ
Q8X061_NEUCR/25-131 QDKINRFSRLHQRELALEEELKNKNKEKEELDDLETELELVEDE..dELVQYKIGDSFFHI.PLEQAKEMLGIAAAKLIKEIEALDDKLETIRKEMTGLKVELYA.RFGKT
Q9AR47_MAIZE/16-120 QQNINRFGRLNNRLHELQDEIKLAKETNENLDDAGNELILSDED...-VVRFQIGEVFAHM.PRDDVETRLEQMKEDAAKKLERLEEEKESILAQMAELKKILYG.KFKDA
Q8LDK1_ARATH/19-123 QQNINIFSRLNNRVHDLDDDIKSAKEKCENLEDAGNELILADEE...-MVRFQIGEVFAHV.PRDDVETKIEEMKEATCKSLEKLEQEKESIVTQMAALKKVLYA.KFKDS
Q7RAS5_PLAYO/64-169 QKKIGKFTNLHYKQSLYQQKIKLMKEKISNIDSAIDEVSLVFDP...NDVMLGIGDCFFSF.DTEYVEESLEKSKNEEKVNLNKLECEYKNITDEKQKLKTELYA.KFGNR
Q8I3A4_PLAF7/20-125 QKKIGKFTNLHYKEPLYEHKIKMMKENIMNIDSSIDEVSLAFDS...NDIMLNIGDCFFKF.DLDYIEEHLEDRKSEELANLNEMELEYKTKLNEKQKLKTELYA.KFGNR
PFD4_CAEEL/12-119 QALLNKFARSYQTQTQLKADVKEAKTLIDNINEASDEILLLDDEd.sASIPCRIGSCFVHF.NGDSLNEHLEGKKTTAEKVLSEKTSELDAISADMEQIKKVLYA.KFGDQ
Q7QQY6_GIALA/22-128 QQMINTFARLHMVYVELAEQRKVLKKRLDDIESASVALLELDDT..eVKPMLAIGAAFFPN.DSMDIDNSLEALKATVSQEYEVVSNRCSKIEAKLNQLRDVLQQ.KFKGS