EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01912 alignment
(8 sequences with 209 aa)


IF6_YEAST/3-204 TRTQFENSN-EIGVFSKLTNTYCLVAVG.GSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDS-VKIQRVEER--LSALGNVICCNDYVALVHPDIDRETEELISDVLGVE-VFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLV.AGTVNRGSSVVGAGMVVNDYLA
IF6_DROME/3-204 LRVQFENND-DIGVFTKLTNTYCLVAIG.GSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVGNRNGLLVPNSTTDEELQHLRNSLPDA-VKIYRVEER--LSALGNVIACNDYVALVHPDLDKETEEIIADVLKVE-VFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLV.AGTVNRGSEVLAAGMVVNDWLS
IF6_CAEEL/3-204 LRVDYEGSN-DVGVFCTLTNSYCLVGVG.GTQNFYSILEAELSDLIPVVHTSIASTRIVGRLTVGNRHGLLVPNATTDQELQHLRNSLPDE-VAIRRVDER--LSALGNVIACNDHVAIVHAEISAETEQALVEVLKVE-VFRVSLAQNSLVGSYCILSSNGCLVAARTPPETQREIAALLQIPVV.AGTCNRGSELIGAGMVVNDWVA
IF6_ARATH/3-206 TRLQYDNNNCEIGVFSKLTNAYCLVSATsASANFFTGYESKLKGVIPIVTTSIGGSGTIGSLCVGNKNGLLLSHTITDQELQHLRDSLPDE-VVVQRIEEP--ICALGNAIACNDYVALVHPKLEKDTEEIISDVLGVE-VYRQTIANNELVGSYCSLSNNGGMVHSNTNVEEMVELANLVQVPLV.AGTVNRGSQVISAGLTVNDWTA
IF6_METJA/5-207 IRKYFSGIP-TIGVLALTTEEITLLPIF.LDKDDVNEVSEVLE--TKCLQTNIGGSSLVGSLSVANKYGLLLPKIVEDEELDRIKNFLKENNLDLNVEIIKSKNTALGNLILTNDKGALISPEL-KDFKKDIEDSLNVE-VEIGTIAELPTVGSNAVVTNKGCLTHPLVEDDELEFLKSLFKVEYIgKGTANKGTTSVGACIIANSKGA
IF6_PYRHO/4-206 ERLDFENSP-YLGVFGVATDRVVLIREG.LQEKKLEVIRETLK--VPVIEVSVMKSRIIGTLATGNSNAIILPWYVWDAEIERIKKALSEYGIDMEVVPFRSKYTALGNLILTNDKAALVSAKFSRKEAQEIGEILGVE-VERGVIAGLHAVGSAGVVTNKGGLVHPETSDEELEWLSDLFKVDVY.VGTANMGVPYVGTCMLANSNGV
IF6_METTH/3-199 RRINLSGNP-NLGVYISVTDSVALIPQN.TPEKFEGVLREALE--VEVLKVSISGSSLNGALAVGNSNGFVVSNQAMDREID----ALAAAGVEAVRIPER--FTAVGNLVLANDNGAVASPLLSDDALQVIGDVLEVD-VKVSTLAGLNIVGSMGAATNRGALLNPQASSEEIGIIEDTLGVEAD.VGTVNHGVTLIGACSVANSNGV
IF6_ARCFU/1-195 MKVAVNGNP-LIGLYAKVSEEYAVVGVN.-HEPLIDAIQEKLD--VDVIVTKIAGSELVGAMMALNSRGAVVSDQVLSSELR----ELEKS-LDVLVIETP--MTCFGNNLLINDRGGIANPEMESSVVEKVADFMDIE-LVKGTVGGIKTVGMAAVVTNRGGLANPNINEWEAKKLQEVAGVEVL.TGTVNFGTDMVGSGLVANSKGY