EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01910 alignment
(11 sequences with 99 aa)


O59567_PYRHO/6-98 VIIEFSIVPMGE--VSISKYVAEIIKLVR----DRGVKYQLTPMGTILEVNSIEEGLSIIRDAHELMFKLGSKRVLTTIRIDERRDKARTMEDKVKSVM
O29684_ARCFU/1-93 MIVEISAVPIGV-GESLSSFVARVIEVLK----EEGVNYSLGPMGTSFEVENFGRLAEILEKVDRALFEAGSPRNYYVIKIDNRAKGGR-MADKVKAVE
Y1052_METJA/7-98 VVAEVSIIPLGK-GASVSKYVKKAIEVFK----KYDLKVETNAMGTVLEG-DLDEILKAFKEAHSTVLND-VDRVVSSLKIDERKDKENTIERKLKAIG
Y1187_METTH/2-96 ITAELTVIPLGTCSTSLSSYVAAAVEALK----KLNVRYEISGMGTLLEAEDLDELMEAVKAAHEAVLQAGSDRVYTTLKIDDRRDADRGLRDKVESVK
O67847_AQUAE/48-140 FLVFVSMTPLGK-GESVSQYVARVVDIID----KSGLPYVLTPMGTIIEGEDWDEVMEVLKKGFEALKEDCN-RISITMKIDYRKGKKGRLIQKVKSVQ
Y1933_MYCBO/3-95 VLVAFSVTPLGV-GEGVGEIVTEAIRVVR----DSGLPNQTDAMFTVIEGDTWAEVMAVVQRAVEAVAAR-APRVSAVIKVDWRPGVTDAMTQKVATVE
Y230_SYNY3/23-115 VIVDLCVVPLGV-GVSVGQYVAACQKVL----AEAGLKHTMHAYGTNIEG-DWDEVFAAVKACHEAVHALGAPRITSSMRFGTRTDRPQTMDEKVKSVE
YQGV_BACSU/2-90 AIADVTIIPIGTETPSVSAYVADVQKILEGYQAEGKIKYQLTPMNTLIEG-ELSDLFAVIQAIHEAPFQK----DCT-----EWQRISVSMTGVTKKRR
DGLA_STAXY/2-99 AIVDVVVIPVGTDGPSVSKYIAEIQTKLKEYKAQGKIDYQLTPMNTLIEG-DLKDLFEVVQAIHELPFDKGLSRVCTNIRIDDRRDKSRNMNEKVKAVE
ECM15_YEAST/6-99 CLADVCMVPIGTDSASISDFVALIEKKIR----ESPLKSTLHSAGTTIEG-PWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVL
Y1503_CLOPE/4-95 CNVSLQILPSVE-DSRLYEVVDKVIEYIE----STGVKFEVGPMETTMEG-KIDDLLEIVKKSQEICIEEGAGRVISIVKIDYKKGGVT-MDEKVGKYR