EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01848 alignment
(7 sequences with 50 aa)


SRNB_ECOLI/19-68 FMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
HOKE_ECOLI/1-50 MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK
HOKA_ECOLI/1-50 MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
PND1_ECOLI/1-50 MPQRTFLMMLIVVCVTILCFVWMVRDSLCGFRIEQGNTVLVATLAYEVKR
HOKC_ECOLI/2-50 KQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE-
HOKB_ECOLI/1-49 MKHNPLVVCLLIICITILTFTLLTRQTLYELRFRDGDKEVAALMACTSR-
HOK_ECOLI/3-52 LPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK