EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01819 alignment
(3 sequences with 133 aa)


O64310_9VIRU/2-132 AKLNKVTLTGIGKAGNQTLTLTPRGVNPTNGVASLSEAGAVPALEKRVTVSVAQPSRNRKNYKVQIKLQNPTACTKD-ACDPSVTRSGSRDVTLSFTSYSTERER-ALIRTELAALLKDDLIVDAIDNLNPAY
COAT_BPQBE/1-132 AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEER-AFVRTELAALLASPLLIDAIDQLNPAY
COAT_BPGA/1-127 ATLRSFVLVDNGGTGNVTVVP----VSNANGVAEWLSN-NSRSQAYRVTASYRASGADKRKYAIKLEVPKIVTQVVNGVELPGSAWKAYASIDLTIPIFAATDDV-TVISKSLAGLFKVGNPIAEAISSQSGF