EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01767 alignment
(6 sequences with 258 aa)


Q96724_9VIRU/727-984 NPFMNTNPFLEELDQPIPSNAAKPISEETRDLFLSDGQTIPSSQEKIATIHEYLLEHKELEEAMFSLISQGRGRSLINMVVKSALNIETQSREVTGERRQRLERKLRNLENQGIYVDESKIMSRGRISKEDTELAMRIARKNQKDAKLRRIYSNNASIQESYTVDDFVSYWMEQESLPTGIQIAMWLKGDDWSQPIPPRVQRRHYDSYIMMLGPSPTQEQADAVKDLVDDIYDRNQGKGPSQEQARELSHAVRRLISH
POLS_IPNVN/723-939 IKYLG-----ELMASNASGMDEELQRLLNATMARAKEVQDAEIYK-LLKLMAWTRKNDLTDHMYEWSKEDPDALKFGKLISTPP-----------KHPEKP----------KGPDQHHAQEARATRISLDAVRAGADFATPEWVALNNYRGPSPGQ-----------FKYYLITGREPEPGDEYEDYIKQPIVKPTDMNKIRRLANS---VYGLPHQEPAPEEFYDAVAAVFAQNGGRGPDQDQMQDLRELARQMKRR
O55651_9VIRU/723-939 IKYLG-----ELMRTTASGMDEELQKLLHATMARAKEVKDAEVFK-LLKLMSWTRKNGLTDHMYEWSKEDPEAVKFGKLISTPP-----------KHQEKP----------KGPDQHTAQEAKAVRISLDAVKAGADFASPDWIAENGYRGPSPGQ-----------FKYYVITGRVPDPRDEYEDYVRKPITRPTDMDKIRRLANG---VYGLPHQEPAPEEFYQAVVEIFAENGGRGPDQDQMQDLRDLARQMKRR
POLS_IPNVJ/723-939 IKYLG-----QLMRTTASGMDAELQGLLQATMARAKEVKDAEVFK-LLKLMSWTRKNDLTDHMYEWSKEDPDAIKFGRLVSTPP-----------KHQEKP----------KGPDQHTAQEAKATRISLDAVKAGADFASPEWIAENNYRGPSPGQ-----------FKYYMITGRVPNPGEEYEDYVRKPITRPTDMDKIRRLANS---VYGLPHQEPAPDDFYQAVVEVFAENGGRGPDQDQMQDLRDLARQMKRR
POLG_IBDVO/739-975 LPYLPPTAGRQFHLALAASEFKETPELEDAVRAMDAAANADPLFRSALQVFMWLEENGIVTDMANFALSDPNAHRMKNFLANAPQ-------AGSKSQRAKYGTAGYGVEARGPTPEEAQRAKDARISKKMETMGIYFATPEWVALNGHRGPSPGQ-----------LKYWQNTREIPEPNEDYPDYVHAEKSRLASEEQILRAATS---IYGAPGQAEPPQAFIDEVARVYETNHGRVPNQEQMKDLLLTAMEMKHR
POLS_IBDVP/720-956 LPYLPPNAGRQYHLAMAASEFKETPELESAVRAMEAAANVDPLFQSALSVFMWLEENGIVTDMANFALSDPNAHRMRNFLANAPQ-------AGSKSQRAKYGTAGYGVEARGPTPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQ-----------LKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATS---IYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKHR