EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01766 alignment
(4 sequences with 453 aa)


Q8AZM0_9VIRU/6-428 ENTQIRYLNSLLVPETGSTSIPDDTLDRHCLKTETTTENLVAALGGSGLIVLFPNSPSGLLGAHYTKTPQG-SLIFDKAITTSQDLKKAYNYARLVSRIVQVRSSTLPAGVYALNGTFNGVTYIGSLSEIKDLDYNSLLSATANINDKVGNVLVGDGVAVLSLPAGSDLPYVRLGDEVP---SSA--GVARCSPSDRPRHYNANNKQ-------VQVGTTDTKTNGFNIDATTPTEVTVDMQIAQIAAG-KTLTVTVKLMGLTGAKVASRSETVSGNG--GTFHF-----STTAVFGETEITQPVVGVQVLAKT-------NGDPI--VVDSYVGVTVHGGNMPGTLRPVTIIAYESVATGSVLTLSGISNYELIPNPELAKNIQTSYGKLNPAEMTYTKVVLSHRDELGLRSIWSIPQYRDMMSYFREVSDRSSPLKIAGAFGWGDLLSGIR
Q9IP80_IBDV/8-452 TQQIVPFIRSLLMPTTGPASIPDDTLGKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNG-NYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTVNAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPISAIGLDP-KMVATCDSSDRPRVYTITAADDYQFLSQYQTGGVTITLFSANIDAITSLSIGGELVFQTSVQD-LVLGATIYLIGFDGTTVITRAVASDNGLTAGTDNL----MPFNLVIPTNEITQPITSIKLEIVT-SKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVADLNSPLKIAGAFGFKDIIRAIR
O55651_9VIRU/4-453 TKATATYLRSIMLPENGPASIPDDITERHILKQETSSYNLEVSDSGSGLLVCFPGAPGSRVGAHYKWNANQTRQEFDQWLKTSQDLKKAFNYGRLISRKYDVQSSTLPAGLYALNGTLNAATFEGSLSEVESFSYNSLMSLTTNPQDKVNNQPVTKGVTVLNLPTGFDKPYVRLEDETPQGPQSMNGARMRCTAAIAPRRYEIDLPS--ARLPTVPATGTLTTMYEGNADIVNSTTVTGDISFRLDQDP-PNDTKYDFQLDFLGLDNNVPVVSITSYTLATTDNYRGVSVKFTQSIPTETITKPITRVKLSYKINQQTAIGNAATLGPLGPSSVSFSSGNGNVPGVLRPITLVAYEKMTPQSILTVAGVSNYELIPNPELLKNMVTKYGKYDPEGLNYAKMILSHREELDIRTVWRTEEYKERTRAFNEITDFSSDLPTSKAWGWRDIVRGIR
Q96724_9VIRU/1-442 MNTTNEYLKTLLNPAQFISDIPDDIMIRHVNSAQTITYNLKSGASGTGLIVVYPNTPSSISGFHYIWDSATSNWVFDQYIYTAQELKDSYDYGRLISGSLSIKSSTLPAGVYALNGTFNAVWFQGTLSEVSDYSYDRILSITSNPLDKVGNVLVGDGIEVLSLPQGFNNPYVRLGDKSPSTLSSPTHITNTSQNLATGGAYMIPVTT-------VPGQGFHNKEFSINVDSVGPVDILWSGQMTMQDEWTVTANYQPLNISGTLIANSQRTLTWSNTGVSNGSHYMNMNNLNVSLFHENPPPEPVAAIKININY----GNNTNGDSSFSVDSSFTINVIGGATIGVNSPTVGVGYQGVAEGTAITISGINNYELVPNPDLQKNLPMTYGTCDPHDLTYIKYILSNREQLGLRSVMTLADYNRMKMYMHVLTNYHVDEREASSFDFWQLLKQIK