EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01753 alignment
(19 sequences with 44 aa)


YB2A_SCHPO/482-523 NLLCNKWEEHSRQFAKCRRCRRTKYCSKECQHQAWP-.GHSRWC
YMZ0_YEAST/514-555 NFSCGKWEDFPRQFAKCRRCKRTKYCSRKCQLKAWG-.YHRYWC
O42631_EMENI/546-587 NYKCGKWEEFTRQFAKCRRCRRTKYCSKDCQKAAWL-.YHRHWC
SMYD1_MOUSE/47-85 CHTCFKRQ---EKLHRCGQCKFAHYCDRTCQKDAWL-.NHKNEC
P91821_CAEEL/49-90 CANCLRGPAPGEKLLRCGGCNFSMYCSKECQATAWL-.VHKPEC
O45918_CAEEL/39-79 CTYCGSSCTSS-QLQTCLFCGTVAYCSKEHQQLDWL-.THKMIC
PDCD2_MOUSE/134-171 CRVCGCLAP-----MTCSRCKQAHYCSKEHQTLDWRL.GHKQAC
O04261_ARATH/216-254 CTWCGTWKGD----KLCSGCKNARYCSPKHQALHWRL.GHKTEC
Q21826_CAEEL/146-182 CRICGCSAA-----KKCAKCQVARYCSQAHQVIDWP-.AHKLEC
YRM4_CAEEL/26-64 CNQCLTSM---AELKKCSACRRLAYCSQECQRADWK-.LHKVEC
Q19132_CAEEL/716-756 CHECGNSKLKLK---ACEECYDAVYCSKECQVANWSTgGHREEC
O81780_ARATH/61-98 CSVCGNFSTK-----KCSRCKSVRYCSAECQRSDWSS.GHQRNC
DEAF1_DROME/521-557 CANCNREALA-----ECSLCRKTPYCSEFCQRKDWN-.AHQVEC
DEAF1_HUMAN/504-540 CVNCGREAMS-----ECTGCHKVNYCSTFCQRKDWK-.DHQHIC
Q24037_DROME/593-629 CWNCGRKATE-----TCSGCNMARYCSASCQYRDWD-.SHHQVC
MTG8_HUMAN/515-551 CWNCGRKASE-----TCSGCNTARYCGSFCQHKDWE-.KHHHIC
ZMY11_HUMAN/523-558 CYNCEEEAMY-----HC--CWNTSYCSIKCQQEHWHA.EHKRTC
O01918_CAEEL/151-185 CWSCDNEAIY-----HC--CWNTAYCSVECQQGHWQ-.THRKFC
ZMY10_HUMAN/394-430 CAYCSAEASK-----RCSRCQNEWYCCRECQVKHWE-.KHGKTC