EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01745 alignment
(7 sequences with 240 aa)


IPT_RHOFA/20-252 PGVYAIVGATGIGKSAEASKLALSHSAPIVVADRIQCYSDLLVTSGRAFDAKVEGLNRVWLD-NRTIHQGNFDPDEAFDRLIKVLTSYVDRGEAVVMEGGSISLILRFAQTISN-LPFPAVVNVMPIPDRQHYFAQQCARARQMLRGDSTGRNLLTELAEAWVLGDQHNFIASVAGLDCVLDWCATHSVTPEELANRDLTTEVLDELAASMGGRYVEHGVLQQEIFLRT-----FGAPGV
IPT_PSESS/1-231 MKIYLIWGATCTGKTEHSIKLSKSTGWPVIVLDRVQCCFDIATGSGRPHPEELQSTRRIYLD-NRRISEGVISAEEANDRLKLEVNKHID-SGGVILEGGSISLLKLISKDPYWCDRFIWSQHRMRLQDTDVFMDKAKARVRRMLVGSTETTGLLDELVAAQSDLNAKLAIQDIDGYRYIMNYAQARRLSITQLLNVMTG-DMKEELINGIALEYYEHAKWQERDFPAE------WLAER
IPT1_AGRVI/1-233 MEAHLIFGPTSTGKTSVAIALAKRTGFPVIVLDRIQCYSQLSVGGGRPSAAEFQGTRRIYLI-EGSLDEGVISAERAHECLVAAVEAHKP-EGGVILEGGSISLFKRMAQSSYWNCGFTWHVTRLHLGGEEIFLAAAKKRINQMMQPDEQGNSFLGELVSVWKTTALRATLEGICGYRYAIEFAGKQGLEMDALTSLNR--RQLEQLVHGMAHEYLCYARQQEQELPLP---SLAGGEGP
IPT_AGRTU/1-235 MDLRLIFGPTCTGKTSTAIALAQQTGLPVLSLDRVQCCPQLSTGSGRPTVEELKGTTRLYLD-DRPLVKGIITAKQAHERLIAEVHNHEA-KGGLILEGGSISLLRCMAQSRYWNADFRWHIIRNELADEESFMSVAKTRVKQMLRP-SAGLSIIQELVQLWREPRLRPILEGIDGYRYALLFATQNQITPDMLLQLDA--DMENKLIHGIAQEFLIHARRQEQKFPLVGATAVEAFEGP
IPTZ_AGRT7/1-232 MILHLIYGPTCSGKTDMAIQIAQETGWPVVALDRVQCCPQIATGSGRPLESELQSTRRIYLD-SRPLTEGILDAESAHRRLIFEVDWRKS-EDGLILEGGSISLLNCMAKSPFWRSGFQWHVKRLRLGDSDAFLTRAKQRVAEMFAIREDRPSLLEELAELWNYPAARPILEDIDGYRCAIRFARKHDLAISQLPNIDA--GRHVELIEAIANEYLEHALSQERDFPQWP----EDGAGQ
IPT_PANAY/3-236 GNVYLLWGATTTGKTAFSVSVAKERGWSVIALDRFQGYHEISTGSGAPTNNELEKTERIYITPQRGLADGIITAKDYNYWLKSRVLSLPEGKSDFIIEGGSVSLLKEMVSDEFW-ADFLWEIKIFRAPSKDVFIKRAKRRITDMLHPEDGRPSIMDEVSSFFMNHKTIHPLEDIDGYRTIIDYCRCKKIGFDKLKIMTT--DQEKIIISGIAEEYYAHALWQEQETPCFP---HSWSRRW
IPT2_RALSO/3-236 IRLYLIWGATTTGKTAQSVALARATGAPVISLDRVQCCHELAVGSGRPLPSELLGTRREYLC-DRSVSSGVIPAADANQLLFDKVVRYSAHERALILEGGSVSLINAMIRDARWSALGEWALRRIVLPGRAVFIAQAIKRVRDMLEPPPGHASILDELEGLWAHPGNHAVLEDVDGYRQIIRYARASQVPIDRITSIDR--STMATLVERIAQEYWEHALWQEQEFLGIP---ATWRRAD