EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01726 alignment
(7 sequences with 65 aa)


LEXA_STRCO/25-89 SSGLTDRQRRVIEVIRDSVQRRGYPPSMREIGQAVGLSSTSSVAHQLMALERKGFLRRDPHRPRA
LEXA_BACSU/1-65 MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDPTKPRA
LEXA_THEMA/1-64 MKDLTERQRKVLLFIEEFIEKNGYPPSVREIARRFRIT-PRGALLHLIALEKKGYIERKNGKPRA
LEXA_PSEAE/1-65 MQKLTPRQAEILSFIKRCLEDHGFPPTRAEIAQELGFKSPNAAEEHLKALARKGAIEMTPGASRG
LEXA_ECOLI/1-65 MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRG
LEXA_AERHY/1-65 MKPLTPRQAEVLELIKANMNETGMPPTRAEIAQKLGFKSANAAEEHLKALAKKGVIEIMPGTSRG
P73722_SYNY3/1-65 MEPLTRAQKELFDWLVSYIDETQHAPSIRQMMRAMNLRSPAPIQSRLERLRNKGYVDWTDGKART