EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01721 alignment
(11 sequences with 36 aa)


SAKP_LACSK/19-54 KYYGNGVHCGKHSCTVDWGTAIGNIGNNAAANWATG
MUTI_ENTMU/1-36 KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATG
PPA1_PEDAC/19-54 KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATG
LCCC_LEUME/1-36 KNYGNGVHCTKKGCSVDWGYAWTNIANNSVMNGLTG
Q47784_ENTFC/24-59 KYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGG
BAVM_LACSK/2-37 KYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGG
LCCA_LEUGE/25-60 KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGF
SAKA_LACSK/20-55 RSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASG
O30434_ENTFC/30-65 RSYGNGVYCNNSKCWVNWGEAKENIAGIVISGWASG
CBB1_CARPI/20-55 ISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASS
CBB2_CARPI/19-54 VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSG