EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01695 alignment
(16 sequences with 184 aa)


Y4UH_RHISN/53-230 NKRLALRLRNAKLH-HPAVPEDIIRRAPREYDRTILDLL-IAGDWIRKHENCAIVGPTGIGKSWLACALGHKACR.DNHSVLYVRMPALLQSLEQARGIGSLATRLKSLGAV.ELLILDDYGLQPIDGNAPHYLLEILEGRYGRRSTLVTSQFPVARWHEKIS.DPTYADAILDRLVHNA.HRL
Y4PL_RHISN/53-230 DRKLAARLRFAKLR-HQAVPEDVDYRSERGLDRALFMKL-IGGDWIDAHDNLAICGPSGVGKSWLACALGHKACR.DDRSVLYQRVPRLFANLALARGDGRYARLQRTLGHV.QLLILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQLPVSAWHEIIG.NPTYADAILDRLVHNA.HRI
Y4BM_RHISN/58-236 DKRIRNRLASAKLRFAQACIEDIDFAAARGLDRRNTMAL-AQGQWLTAHEGLIITGHTGTGKSWLACAFGRQAAR.LGHSVLYVRVPRMFEELALARLDGSFPRLIDRLTRV.QLLILDDFGTHTLSDQQRFHLFEIVEERYQRKSTLITAQVPVASWHDLIA.DSTVADAILDRIVHNA.HRI
ISTB_PSEFL/53-231 DKRLERLRKQAKLKYASACLEDLDRRRGRTLDERLIATL-ASGDWIRQRHNLLLTGPTGVGKTWFACALGHQACR.QGYSALYLRTPRLLEQLRIAHGDGSFGRTLQQLAKV.DVLILDDWGLAALEENARHDLLEVIDDRAGSRSTILTSQLPSSTGTAGST.TPRWPTPCSIAWYTTP.TES
P96960_PSEAC/242-419 DKRLSSRLRQARLKHN-ACLEDIDYRSPRGLDKALILQL-SGGQWLRDGLNLIIGGPTGVGKTWLACALAHQACR.EGYSVRYLRLPRLVEELGLAHGDGRFAKLMSSYAKT.DLLILDDWGLARSPPNSGATCWSYWTTATVSARPSLPGRCRWDNWHELIG.DPTLADAILDRLVHNA.YRI
Y4IQ_RHISN/60-238 HRRIERHLAEAHLP-PGKTLESFAFDAVPMVSKAQVMAIAAGDSWLAKGANILLFGPPGGGKSHLAAAIGLALIE.NGWRVLFTRTTDLVQKLQVARRELQLESAIAKLDKF.DLLILDDLAYVTKDQAETSVLFELISARYERRSIMITANQPFGEWNRVFP.DPAMTLAAVDRLVHHA.TIF
Q57115_PSEAE/54-231 VRSVNYQLRVAKFP-VYRDLVGFDFSQS-LVNEATVKQL-HRCDFMEQAQNVVLIGGPGTGKTHLATAIGTQAVMhLNRRVRFFSTVDLVNALEQEKSSGRQGQIANRLLYA.DLVILDELGYLPFSQTGGALLFHLLSKLYEKTSVILTTNLSFSEWSRVFG.DEKMTTALLDRLTHHC.HIL
P95447_PSEAC/1-179 MRSVSHQMNMAKLP-MHRDLAGFDFSAS-SADARLISEL-ANLSFTDTAQNVVLIGGPGTGKTHLATALAVSGITrHGKRVRFYSTVDLVNLLEREKHDGKAGRIAQALLRM.DLVILDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSSVFG.DAKMTTALLDRLTHHCqHSS
P74994_ECOLI/56-235 QRKQAMYTRMAAFP-AVKTFEEYDFTFATGAPQKQLQSL-RSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAVR.AGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVMApRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAgDAALTSAMLDRILHHS.HVV
ISTB_BACTB/55-232 QNMIHSMVKMGAFP-HRKEVDEFDFEFQPSINKQQILDF-ISLRFLEQQENIVFLGPSGVGKTHLATSIGIAAAK.KRTSTYFIKCHDLLQNLKRAKIENRLESRLKHYTKY.KLLIIDEIGYLPIDPEDAKLFFQLIDMRYEKRSTILTTNINFKSWDEVFQ.DPKLANAILDRVLHHA.TVV
O69925_STRCO/56-233 DRRFRNGLRLSKLP-HHKTLEDYDFSFQPDLDPRKVKDL-ATLSFIEDKANVALLGPPGVGKTHIAVALAVAACR.AGYSIYFTSLDDMVRHLKAAEDQGRLISKLTSYLRP.AVLVVDEVGYQPLERAEANLVFQVISKRYEKGSIILTSNKTFGEWGQVFG.DEVLATAILDRLLHHC.EVV
ISTB_PSEAE/51-228 QRGMESRLKQARLP-WVKTLEQFDFTFQPGIDRKVVREL-AGLAFVERSENVILLGPPGVGKTHLAIALGVKAVD.AGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYA.RVLILDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFG.DHVLATAILDRLLHHS.TTL
ISTB_BACST/52-229 ARSIQTLIKLSKLP-YRKTIDTFDFTAQPSVDERRIREL-LTLSFIDRKENILFLGPPGIGKTHLAISIGMEAIA.RGYKTYFITAHDLVNQLRRADQEGKLEKKLRVFVKP.TVLIIDEMGYLKLDPNSAHYLFQVIARRYEHAPIILTSNKSFGEWGEIVG.DSVLATAMLDRLLHHS.IIF
O06369_MYCTU/63-223 SHGGEGRIRAARFP-SRKSLEEFDFDHARGLKRDTIAHL-GTLDFVT----LAIG-------------IAIRACQ.AGHRVLFATASQWVDRLAAAHHSGTLQSELIRLARY.PLLVVDEVGYIPFEPEAANLFFQLVSSRYERASLIVTSNKPFGRWGEVFG.DDVVAAAMIDRLVHHA.EVI
ISTB2_BACFR/61-238 RKSYLTRLKLSGLP-AKYDLDLYDYDRAEGMDNRRLREL-RELVWVNQAYNLLLVGPSGTGKTFIAAGLVYEAVK.AGYEAYLMTLEELLTCLKTKEVSAHAMKTYKRIMKA.RLLAIDDATLFPLKREEAVLLFKLVNDFQERTSLIITANKALTRWLETLE.DEAVTAALLDRLLYCC.EII
O07445_RHOER/66-241 RANLHTRRKRAGFP---TGKTFGDWDETKSSIPRATQDALRTLEWVGRRECFCVCGPSGTGKSHFTEALGQAAVE.AGLAVSWFTIEDLGALVRRHRADDSIARALTRIIRS.DLIIVDDIGLLPVSEDAAEGFYRLVDAAYERRAIAVSSNLHPSGFDEIMP.-KTLATATVDRLLHHA.HVV