EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01679 alignment
(12 sequences with 53 aa)


YV31_CAEEL/6-57 QQIIELILAIFLPPLAIFIHGNDCNMHVAVNIILCFFF.FVPAVIHALWYCFF
P91491_CAEEL/32-83 KLVLLIILIVIFPPAAVAVHANECNMHVFISLILVFFF.MIPSYIHAIWYCFF
P92009_CAEEL/25-76 DRLVMALMWLILPPMAVYFKSRGCTKHVCLNVLLYFFL.ILPSYIHATWYCFV
O18038_CAEEL/25-76 DRLVMVLLMLVLPPMAVYFKGRGCTKHVLINIFLYILL.VLPAYKHATWFCFV
YQAE_ECOLI/1-51 MGFWRIVITIILPPLGVLLGKG-FGWAFIINILLTLLG.YIPGLIHAFWVQTR
Y1169_SYNY3/1-52 MDIVKIICAILLPPLGVFLQVG-IGKDFWINLLLTIFGlYILGLVHAIWVIAR
YOT0_CAEEL/2-52 CQILLAILAIFLPPIAVLLDVG-CNCDLLINILLTCLG.IIPGIIHAWYIILC
YCU3_CAEEL/6-56 TDIPKFICAVLLPPIGVFLEKG-CDYHLAICILLTILG.YIPGIIYACYVILA
LT01_HORVU/4-54 ATVLEVILAIILPPVGVFLRYK-LGVEFWICLLLTILG.YIPGIIYAVYVLVV
YD23_YEAST/11-62 SDFILYIVAFFFPPAAVLLRSGPCSSDFLLNVLLTLLG.FLPGMLHAFYYITI
PMP3_YEAST/4-54 AKIINIILSLFLPPVAVFLARG-WGTDCIVDIILTILA.WFPGMLYALYIVLQ
YAM5_CAEEL/6-57 DVIIEVILCIFLPPLAIWWHTKECDINVLIDIIFCLLF.WLPGILYAVYICFF