EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01668 alignment
(13 sequences with 72 aa)


SSRP_SYNY3/9-77 KVV--SDNRQARFLYEILETYEAGIELQGTEVKSIRA.GKVNLRDGFALLRDGEVWLMNVHISPYDKSSLFF
SSRP_BACSU/7-74 KVL--SQNKKANHDYFIEETYETGIVLQGTEIKSIRA.GRVNLKDSFAKIERGEVFLHNMHVSPYEQGNR-Y
SSRP_HELPY/2-70 KLI--ASNKKAYFDYEILETLEAGLALLGSEVKALRQ.TRVNLKDNFVKIIKGEAFLFGVHISYLDTIHAYY
SSRP_AQUAE/6-76 KIIPIAENKEAKAKYDILETYEAGIVLKGSEVKSLREkGTVSFKDSFVRIENGEAWLYNLYIAPYKHATI-E
SSRP_MYCLE/10-77 QIV--ATNRKARHDYAIIELFEAGVALLGTEVKSLRE.GHASLADAFATVDSGEVWLRNMHIPEYQHGSW-T
SSRP_RICPR/6-73 KVI--VQNKKALFNYFIEEILEAGIVLKGSEVQSLRQ.GKASIEESHASDNGHEVFLYNCHITEYEKANR-F
SSRP_BORBU/5-72 NLL--LENKKAKFNYFIEEKISCGIVLKGTEVKSIKA.KKLSFNNSFASIKKEELWLENLHVSKYKEGNI-F
SSRP_HAEIN/11-79 NTI--ALNKRARHDYFIEDEIEAGLELQGWEVKSMRA.GKANISDSYVIFKNGEAFLFGASIQPLNVASTHI
SSRP_ECOLI/11-79 ATI--ALNKRARHEYFIEEEFEAGLALQGWEVKSLRA.GKANISDSYVLLRDGEAFLFGANITPMAVASTHV
SSRP_VIBCH/13-79 NTI--ALNKKARHEYFIEDEFEAGMELQGWEVKSLRQ.GKANIAESYVYIKDGEAFISGMTIIPLQQAST--
SSRP_NEIMA/1-69 MAI--ANNKKAFHDFFIEDRIEAGLVLEGWEVKAIRA.ARVQLKESYIYWKKDAFYLVGCHITALPTASTHI
SSRP_MYCPN/2-69 RVL--VNNPRAQYDYYLLTGYCAGLVLKGSEVKSLAL.GQGSLKEAYVFIDKHEVYIKDFSISPYAFSGE-F
SSRP_MYCGE/2-69 LIL--VNNPKAKYDYHLMESYCAGIVLKGSEVKALSL.GQGSLKEAYVFVKNNELFLEQFTIPPYSFAGP-L