EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01659 alignment
(8 sequences with 105 aa)


VPG_PLRV1/52-156 LEFPEDEAQARHSCLQRTTSWATPKEVSPSGRVYQTVRHSRMEYSRPTMSIRSQASYFSSSARPLPPPPVPSLMSWTPIAKYHPSSPTSTSSKLRRAAPKLIKRG
VPG_BYDVN/49-153 LQDLEEEAVARHSFSQRIHSRATPLEVSPSGRLYQSIRHSRMEYSRPTMNIRSQIVSYSSSARPLPQQPAPSLTSWTPIAKHLHSHQQSISSQSPKLVRGASQRR
Q65971_9LUTE/44-147 AEL-EEEAQAKHLYFQRTISRAVPQEVSPSGRLFQRAQHSALEYSRPTMNIRSSWSSWSSSPRPLPPPRVPSLMSWTPTASLAPSNPRLINLESPRVDCDVGPLS
Q08404_9LUTE/48-152 AIFPEDQARLTHSCFQRTASMVVPREVSLSGRLYQNASHSLMEYSRPTMNIRSRVSYYSSSPRPLPPRQVPSLMNLTHTASTPKFNRYSINSVSQRAVRNVSQPE
VPG_BWYVF/45-149 LFLPEEQVRARHLFSQKTISREVPAEQSRSGRVYQTARHSLMECSRPTMSIKSQWSFWSSSPKPLPKIPVPSLTSWTHTVNSTPFPQLSTSSGSQSPGKGRLQRL
VPG_BLRV/1-105 MDLPEDQARFTNSYSLRTTSMETPREVSRSGRLYQSASRSQMAYSRPTMSIISRTSSWRTSPRPLPPPQVPSLMNSILTSRTQQSSPKLTNSASPNLRRKSSLGR
VPG_BYDVR/38-142 ILYLDQQAGLRYSYSQSTTLKPTPPGQSNSAPVYRNAQRFQTEYLSPTTVTRSQVSVLSLSHTRPQLRPALSLLNSTPRANNQPWVATLIPSQSAGPPQRSSEPK
VPG_BYDV1/39-143 ILYLDQQAGLRYSYSQSTTLRPTPQGQSSSVPTFRNAQRFQVEYSSPTTFTRSQTSRLSLSHTRPPLQSAQCLLNSTLGAHNQPWVATLTHSPSQNQQPKPSPPN