EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01638 alignment
(13 sequences with 92 aa)


YYBR_BACSU/22-112 VIGGKWKGILFYHMID-GKKRFNEFRRICPSITQRMLTLQLRELEADGIVHREVYHQVPPKVEYSLTEFGRTLEPIVLQMKEWGESNRDVLE
YDEP_BACSU/26-116 IIGGKWKGILLYHLID-GKKRFNEFRKLYPKITQRMLTLQLRELERDGVIHREVYKQVPPKVEYSLTEFGRTLEPVILHMKDWGEKYKDRID
YCKH_BACSU/19-110 VIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLREREQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELID
YTCD_BACSU/16-106 VIGGKWKCVILCHLTH-GKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINRVY
YKVN_BACSU/14-104 VIGGKWKGLVLYFLMN-GPKRTSELKRIIPNITQKMLIQTLRELEASGLVSRKMYNQVPPKVEYSSTELGESLKPILQELCQWGGYYAEQEY
Y1285_METTH/34-124 EIGGKWKSLVLCTLKD-GKLRFSEINRRIPKITQRMLTRTLRELESSGLINREVYPEVPPRVEYCLTEKGKSVIPILDALCEWGKMYGSHQE
P70885_BUTFI/18-108 LIGSKWKLLIIRNLLV-RPWRFNELKNNLEGISQKVLTDSLRSMEEDGIITRTVYPEVPPRVEYSLSELGESMRPIIKAMEQWGTEYKETLD
YDZF_BACSU/18-109 LIGGKWKMRILYELGCEKTMRYGELKRAMPFITHKMLSAQLKELQTDGLIHRSEVSHTPLKVEYSLSDRGRSLYPLIDEMCKWGMAQGGPHM
Y1512_SYNY3/33-123 LLDNKWSILVLRELFK-GQRRTGQLLDALPGCSTKTLTLRLRQLETHGIINRDVYPEIPPRVEYSLTARGREIQPVLIAMHKLGSDWLEQES
YODB_BACSU/15-105 LLGKRWNGLIIHVLMD-GPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEPGD
O32238_BACSU/99-189 ILSKRWVALIVFQLLN-GSQRFSEIEAALPNLSGRVLSERLKELELEGVVKRDVIPETPVRIEYSLTDKGKALAPILGEISKWATEWIDPSF
P71983_MYCTU/16-103 LLGDRWTLLIVRELLF-GPLRFTEIERGLPGISRSVLAQRLRRLQHDRIIEAVPEHTGGG---YRFTVAGEELRPVLQTLGDWVSRWLMADP
Y3095_MYCTU/21-110 LVGERWTLLILREAFF-GVRRFGQLARNL-GIPRPTLSSRLRMLVEVGLFDRVPYSSDPERHEYRLTEAGRDLFAAIVVLMQWGDEYLPRPE