EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01630 alignment
(12 sequences with 349 aa)


HYAL1_RAT/38-374 YRATPVLSDTTFVWVWNVPTEACVENVTEPIDLSF.FSLIGSPRKTAIG-QPVTLFYVDRLGNYPHIDAQQ----TEHHGGIPQKGDLTTHLVKAKEDVERYIPT-DKLGLAIIDWEEWRPTWMRNWTPKDIYRNKSIELVQAADPAINITEATVRAKAQFEGAAKEFMEGTLKLGKHIRPKHLWGFYLFPDCYN-NKFQVDN--YDGQCPDVEKKRNDDLDWLWKESTGLYPSVYLKKDLKSSRKA-TLY-VRYRVLESIRVSKVSDESNPVPIFVYIRLVFTDHVSEYLLEDDLVNTIGEIVAQGTSGIIIWDAMSLAQRSAGCPILRQYMKTTLNPYIVNVTLAAK
HYAL1_MOUSE/38-374 YRAAPILSNTTFLWIWNVPTERCVGNVNDPIDLSF.FSLIGSPRKTATG-QPVTLFYVDRLGLYPHIDANQ----AEHYGGIPQRGDYQAHLRKAKTDIEHYIPD-DKLGLAIIDWEEWRPTWLRNWKPKDNYRNKSIELVQSTNPGLSITEATQKAIQQFEEAGRKFMEGTLHLGKFLRPNQLWGYYLFPDCYN-NKFQDPK--YDGQCPAVEKKRNDNLKWLWKASTGLYPSVYLKKDLKSNRQA-TLY-VRYRVVEAIRVSKVGNASDPVPIFVYIRLVFTDRTSEYLLEDDLVNTIGEIVALGTSGIIIWDAMSLAQRAAGCPILHKYMQTTLNPYIVNVTLAAK
Q29152_VULVU/38-375 FRAPPFIPNVSFLWGWNAPTELCAKRFNVQLDLNL.FSLIGSPLKTVVG-QGIAIFYADRLGYYPHINKTTG---KHVNGGIPQLGSLKKHLDKAKKDISHYIET-DSMGLAVIDWDSWRPNWARNWRPKHIYKEQSIDLAQQQHIHLNLTEVTQIAQADFEKAARCFMQETLKLGKFLRPNYLWGFYLYPDCYN-YNYKNPN--YNGSCYDIEERRNDEIDWLWKESTALFPSIYLKSKLKSSPFT-ALY-VRNRVLEAIRVSKVKDIKHPLPIFVYARPVFTDVLLTYLTEDDLVNTIGESVSLGVSGIVMWGSLNLTENVQICTELDTYIKNKLNPYIINVTLAAK
HYAL1_RABIT/38-378 FRAPPVIPNVPFLWAWNAPTEFCLGKSGEPLDMSL.FSLFGSPRKNKTG-QGITIFYVDRLGYYPYIDPHTG---AIVHGRIPQLGPLQQHLTKLRQEILYYMPK-DNVGLAVIDWEEWLPTWLRNWKPKDIYRIKSIELVKSQHPQYNHSYATEKAKRDFEKAGKDFMEETLKLGRLLRPNHLWGYYLFPDCYN-HHYDKPN-LYKGSCFDIEKKRNDDLSWLWKESTALFPSVYLTSRARSATALSKLYVVRNRVHEAIRVSKIPDDKSPLPNFVYTRLVFTDQIFQFLSHHDLVYTIGEIVALGASGIVVWGSQSLARSMKSCLHLDNYMKTILNPYLINVTLAAK
HYAL1_HUMAN/38-374 FRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDMSL.FSFIGSPRINATG-QGVTIFYVDRLGYYPYIDSITG---VTVNGGIPQKISLQDHLDKAKKDITFYMPV-DNLGMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFPDCYN-HHYKKPG--YNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAAT--LY-VRNRVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKSCLLLDNYMETILNPYIINVTLAAK
O70229_MOUSE/50-384 CRGS-VVSNRPFITVWNGDTHWCLTEYGVDVDVSV.FDVVANKEQSFQG-SNMTIFYREELGTYPYYTPTG----EPVFGGLPQNASLVTHLAHTFQDIKAAMPEPDFSGLAVIDWEAWRPRWAFNWDSKDIYRQRSMELVQAEHPDWPETLVEAAAKNQFQEAAEAWMAGTLQLGQVLRPRGLWGYYGFPDCYN-NDFLSLN--YTRQCPVFVRDQNDQLGWLWNQSYALYPSIYLPAALMGTEKS-QMY-VRHRVQEALRVAIVSRDPH-VPVMPYVQ-IFYEMTDYLLPLEELEHSLGESAAQGVAGAVLWLSSDKTSTKESCQAIKAYMDSTLGPFIVNVTSAAL
Q12794_HUMAN/22-356 FRGP-LLPNRPFTTVWNANTQWCLERHGVDVDVSV.FDVVANPGQTFRG-PDMTIFYSSQLGTYPYYTPTG----EPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYN-YDFLSPN--YTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKS-QMY-VQHRVAEAFRVAVAAGDPN-LPVLPYVQ-IFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGAL
O43820_HUMAN/21-354 QPLP-QVPERPFSVLWNVPSAHCEARFGVHLPLNA.LGIIANRGQHFHG-QNMTIFYKNQLGLYPYFGPRG----TAHNGGIPQALPLDRHLALAAYQIHHSLRP-GFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASN--YTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQ---AFVRHRLEEAFRVALVGHRH-PLPVLAYVR-LTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAM
HYAL2_HUMAN/25-363 PTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNA.FDVQASPNEGFVN-QNITIFYRDRLGLYPRFDSAG----RSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYN-HDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGR--NFVSFRVQEALRVARTHHANHALPVYVFTR-PTYSRRLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSWATQ
Q22675_CAEEL/25-360 YIGSGASQPNRTDVVWMVPSWTCKN--EYSIDVEK.YGILQNEDQHFVGGKQFAIFYEHSFGKIPYFKAQNES--DPKNGGLPQMGDLEAHLIQAEKDINETIPDENFNGIAVIDIEEFRPMWELSWGPFSVYKTESIRLTRQQHPYWSTKQIEWQAERDYEKACQKFFIETLRLGKRLRPNAKWGYYLFPKCNG--DVGQKS---DTDCSTLFQKFNDNLHWLWGESTALFPSIYLYPSQKQNPEYN-FVNSGALITETKRIKRNYCPSCEIHVFTKIEYNPYYTPDDFYSKQNLASTLDLAIKMNANSVVIWSTSQSIGSR--CGSLQTYVDNTLGPYLQLTDRNLD
HUGA_DOLMA/1-331 SERP----KRVFNIYWNVPTFMCHQYGLYFDEVTN.FNIKHNSKDDFQG-DKISIFYDP--GEFPALLPLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWGNMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPYCFN-MSPNNLV----PDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVG---LVQGRVKEAVRISNNLKHS--PKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSSDVNSLSKCKRLREYLLTVLGPITVNVTETVN
HUGA_APIME/36-368 NNKT----VREFNVYWNVPTFMCHKYGLRFEEVSEkYGILQNWMDKFRG-EEIAILYDP--GMFPALLKDPNGNVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYN-LTPNQPS----AQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVG---LVGGRVKEALRIARQMTTSR-KKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKRIALNNN