EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01613 alignment
(22 sequences with 156 aa)


Q55660_SYNY3/11-160 LRKIPHGLYVCGVKS-GEEANGFTASWVMQGSFEPPLVVNCVRTDSISHRLLQESGQFALSFLAAD-QKDVAAQFFKPQRR-.VGDKFENFDVLDAPETGCPVLKDCLGYVECRVVGSVAHGDHTVFVGEVIGAQVFNE--GDPLLLESTGWNYGG
Q07948_SYNP7/11-160 LRKIPHGLYVCGVKD-GEEINGFTASWVMQGSFQPPLVINCVKSDSRSHAMLSASGVFSLSFLEAG-QKDLAAQFFKPQRL-.VANKFETVNAYLGEATGCPILEEALGYVECRVVGKVEHGDHTVFVGEVIAAGLHSE--GDLLTLESTGWNYGG
O68503_RHOER/38-186 LRRHPAGVTVVTLDS-GTGPVGFTATSFSSVSLEPPLVSFNIAETSSSINALKAAESLVIHLLGEH-QQHLAQRFARSA---.-DQRFADESLWAVLDTGEPVLHGTPSWMRVKVDQLIPVGDHTLVIGLVTRVHAEEDDESAAAPLLYHEGKYYR
O68914_9ACTO/25-171 MSCFPAGVVLVTTREEDGTPRGFTASSFCSVSLAPPLVSVCQGTGAQSYGAFQECARFAVSVLRSG-QRELASRFATRG---.-ADKFGGGGLVALEGSGLLVAADALVTLECAVHARHLAGDHVILVGEVRGVGQGE---GEPLVHWERGFRALR
DIM6_STRCO/12-158 MARVPAGVALVTAHDRGGVPHGFTASSFVSVSMEPPLALVCLARTANSFPVFDSCGEFAVSVLRED-HTDLAMRFARKS---.-ADKFAGGEFVRT-ARGATVLDGAVAVVECTVHERYPAGDHIILLGEVQSVHVEEK--GVPAVYVDRRFAALC
SNAC_STRPR/20-167 MAQLASPVTVVTVLDAAGRRHGFTAGSVVSVSLDPPLVMVGIALTSSCHTAMAAAAEFCVSILGED-QRAVAKRCATHG---.-ADRFAGGEFAAWDGTGVPYLPDAKVVLRCRTTDVVRAGDHDLVLGTPVEIRTGDP--AKPPLLWYRRDFHTP
P96849_MYCTU/14-159 LGQFCTGITVITTVH-DDVPVGFACQSFAALSLEPPLVLFCPTKVSRSWQAIEASGRFCVNVLTEK-QKDVSARFGSKE---.-PDKFAGIDWRPS-ELGSPIIEGSLAYIDCTVASVHDGGDHFVVFGAVESLSEVPA--VKPRPLLFYRGDYTG
O69360_RHOER/23-166 LGQFCTGITIITTVD-DGEPVGFACQSFAALSLDPPLVLFCPTKGSRSWAAIERTGKFAVNVLAEE-QQAVCARFGSRE---.-PDKFAGIDWTPS-PLGSPIIDKSLAHIDCTVETVHDGGDHYVVFGRVSSMSEIKT--ER--PLLFYRGQYTG
NTAB_CHEHE/25-169 LGTFPTGVTIVTAPG-VDGPAGVTANSFASVSLDPPLVLWSIGHTSRSHSKFQQSATFAINILADD-QVGVSQVFAGGS---.-ADKFSLVDWHTG-RTGAPLIDNALAYFDCVCEARHEGGDHTIMIGRVVDFGRAE---GSPLAFSQGRYGVTL
P95275_MYCTU/24-167 FGCFPCGVIAVCAMV-DDQPVGMAASSFTSVSVDPPLVSICVQNCSTTWPKLRDRPRLGVSVLAEG-HDAACMSLSRKE---.-GNRFAGVFWSEL-SSGGVVIAGAGAWLDCRPYAEIPAGDHLIALLEICAVRADPE--TP--PLVFHGSRFRR
O53667_MYCTU/16-159 FGHFPTGVVAIAAEV-DGVRQGLAASTFVPVSLEPPLVSFCVQNTSTTWPKLTGVPMLGISVLGEA-HDAAVRTLAAKT---.-GDRFAGLETVSN-DAGAVFIKGTSVWLESAIEQLVPAGDHTIVVLRVNQVKVDPN--VA--PIVFHRSVLRR
O06835_PSEFL/20-166 VALFATGIAVLSAETEEGEVHGMTVNSFTSISLDPPTVMVSLK-SGRMHELLTRGGRFGVSLLGES-QKVFSAFFSKRV---.-MDDTPSPAFTIQ--AGLPTLRDAMAWFECEVESTVQVHDHTLFIARVSACGTPEANAPQPLLFFASRYHGKP
YCDH_ECOLI/13-160 MSCMGAAVNIITTDG-PAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPAFNENRTLCVNTLSAG-QEPLSNLFGGKTP--.MEHRFAAARWQTG-VTGCPQLEEALVSFDCRISQVVSVGTHDILFCAIEAIHRHTT--PYGLVWFDRSYHALM
HPAC_KLEOX/14-163 MASLSPAVNVITTEA-EAGAAVSPHRPSCSVTDTPPSVMVCINANSAMNPVFQGNGKLCINVLNHE-QEEMARHFAGMTGMT.MDDRFGLSGWQKG-ALGQPVLKGALASLEGEISQVQTIGSHLVYLVEIRNITLSQQ--GHGLIYFKRRFHPVM
O68232_PHOLU/15-164 MASLSAAVNIVTTDG-HADAGGITATAVCSITDTPPTLMVCINRSSAMNPVFQENGRLCVNILNHE-QELMARHFAGMTRVS.MEERFSLSIWQTG-PLGQPVLYGTLASLEGEIEQVQSGGTHNVYLVQIKHITVSEQ--GHGLIYFKRNFRPVM
O34138_STRVF/25-175 TRQLPTGVAVVTAQD-GEVAHGATVSTVSVLSQQPLRIGVSLRRGSYLTGLIRQRRVFALNVLSSR-QSAVADWFANPERPR.GWRQFDYVRWTAHPKAGMPVLEDALAQLHCRLTDLIPLGASDDLLVAEVLDGRGRN--GRPLVNFNGRLHDVE
O53254_MYCTU/22-170 MGMLDHPVFVVTTQA-DGHPAGCLVSFATQTSVQPPSFMVGLPRSTGTSEVASRSEHLAVHVLSQR-QHVLAELFGSQTEEE.-VNKFARCSWRAG-PCGMPILDDAAAWFIGRTASRSDVGDYVAYLLEPVSVWAPEC--SEDLLYLSDLDFDVD
DFA1_SYNY3/424-573 IGRISGGLYIITAQK-GEVKGAMLASWVSQASFNPPGFTVAVAKDRAIESLMQVGDRFVLNILEEGNYQILMKHFLKRFPPG.-ADRFAGVKTQTA-SNGSPILTDALAYLECEVASRMECSDHWIVYSQVTNGRVAKA--EGLTAVHHRKVGNYY
DFA2_SYNY3/429-578 IGRLSTGLYILTAQK-GDVRSAMLASWVIQGSFEPLGIVIAVAKDRAIESLLHPGDTFVLNVLEEDNYQSLMRHFLLRFPPG.-ADRFAGVNTYPA-QNGSPILLETLAYLECEVTSRLDGNDHWLVYSTIQTGRVAKL--NALTATHHRKLGNHY
DFA3_SYNY3/449-597 LGRLVGSLCVVTAQQ-GELSSAMLASWVSQATFSPPGLTVAVAKERAIESLLHKNSCFVLNILQEGNHLGLMKHFLKPFAPG.-GDRFADVATETA-ENGAPILTESLAYLECRVQQRLECGDHWVLYAVTDRGALLK---DGVTAVHHRKSGDHY
DFA4_SYNY3/445-594 VGRIIGSIGVVTTQT-TGRHQGILTSWVSQASFTPPGIMLAIPGEFDAYGLAGQNKAFVLNLLQEG--RSVRRHFDHQPLPKdGDNPFSRLEHYST-QNGCLILAEALAYLECLVQSWSNIGDHVLVYATVQAGQVLQP--NGITAIRHRKSGGQY
O29428_ARCFU/6-158 FYKISYGLYIVTSES-NGRKCGQIANTVFQLTSKPVQIAVCLNKENDTHNAVKESGAFGVSVLELETPMEFIGRFGFRKSSE.-FEKFDGVEYKTGKTGVPLVTQHAVAVIEAKVVKECDVGTHTLFVGEAVDAEVLKDAEVLTYADYHLMKKGKT