EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01606 alignment
(3 sequences with 213 aa)


YOR3_PRRSL/1-211 MAHQCARFHFFLCGFICYLVHSALASNSSSTLCFWFPLAH-GNTSFELTINYTICMPCSTSQAARQRLEPGRNMWCKIGHDRCEERDHDELLMSIPSGYDN-LKLEGYYAWLAFLSFSYAAQFHPELFGIGNVSRVFVDKRHQFICAEHDGHNSTVSTGHNISALYAAYYHHQIDGGNWFHLEWLRPLFSSWLVLNISWFLRRSPVSPVSRRI
O55481_PRRSV/1-212 MVNSCTFLHIFLCCSFLYSFCCAVVAGSNTTYCFWFPLVR-GNFSFELTVNYTVCPPCLTRQAAAEIYEPGRSLWCRIGYDRCEEDDHDELGFMVPPGLSSEGHLTGVYAWLAFLSFSYTAQFHPEIFGIGNVSRVYVDIKHQLICAEHDGQNTTLPRHDNISAVFQTYYQHQVDGGNWFHLEWLRPFFSSWLVLNVSWFLRRLPANHVSVRV
Q06499_LDV/1-191 MASFNAIICVFICFSCCCIVDCNVTAP--TKTCLWFPIHETGKTHLELSLNFTLCKMCGVVENSYYSH-P----FCVT-DDTCEESSSQYLDFDFPDDVQL---LTSIYGTIAINALVFAIHQVPEMF--GNVTAIHFSEN--TLCYNS----TPIEHGKNVTTSLAIFDG---DVSKWYVLEYIRPLFSSWLVLNVSYFLRRSTAGRATRRL