EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01599 alignment
(6 sequences with 47 aa)


RS27A_ARCFU/7-50 SIYRYYEIKGEK-VVRKKKFCPR--CGEGVFLAEHKDRLSCGKCGYT
RS27A_METJA/8-51 AKYKYYKIEGDK-VIRLKKTCPR--CGPGVFMAEHLNRYACGKCGYM
RS27A_HALMA/1-40 PHNEYYNDDGE--LDR--ETCPR--CGD-TVLAEHEDRQHCGKCGYT
RS27A_METTH/2-45 KKFELYEVKDGK-LVRKNPFCVR--CSNGVFMADHGDRYACGKCGYT
O14257_SCHPO/101-145 AVLKYYKVEDDGSVKRLRRECPN--CGASTFMANHKDRLYCGRCHLT
O60036_CANAL/101-147 AVLTYYKVDNEGNVERLRRECPAPTCGAGIFMANMKDRQYCGKCHLT