EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01599 alignment
(13 sequences with 47 aa)


RS27A_ARCFU/7-50 SIYRYYEIKGEK-VVRKKKFCPR--CGEGVFLAEHKDRLSCGKCGYT
RS27A_METJA/8-51 AKYKYYKIEGDK-VIRLKKTCPR--CGPGVFMAEHLNRYACGKCGYM
RS27A_HALMA/1-40 PHNEYYNDDGE--LDR--ETCPR--CGD-TVLAEHEDRQHCGKCGYT
RS27A_METTH/2-45 KKFELYEVKDGK-LVRKNPFCVR--CSNGVFMADHGDRYACGKCGYT
O14257_SCHPO/101-145 AVLKYYKVEDDGSVKRLRRECPN--CGASTFMANHKDRLYCGRCHLT
RS27A_NEUCR/25-71 AVLKYYKVDSDGKIDRLRRECPNETCGAGVFMAAMQDRQYCGRCHLT
O60036_CANAL/101-147 AVLTYYKVDNEGNVERLRRECPAPTCGAGIFMANMKDRQYCGKCHLT
RS27A_MANSE/25-71 AVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHST
RS27A_HUMAN/25-71 AVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT
RS27A_SOLTU/25-71 AVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLT
RS37_YEAST/25-71 AVLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKCHSV
RS27A_DICDI/26-72 AVLKYYKFDENGKIKRVLRECPAETCGAGVFMAQHANRQYCGKCHST
RS27A_CAEBR/25-71 AVLKYYKVDENGKITRLRKECQQPSCGGGVFMAQHANRHYCGRCHDT