EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01596 alignment
(8 sequences with 216 aa)


Q55813_SYNY3/17-220 QSISAD--DSFYLAQLRRETAHLP-.GAPMQISPEQAQFLGLLISLTGAKQVLEIGVFRGYSALAMALQLPPDGQIIACDQDPNATAIAKKYWQKAGVAEKISLRLGPALATL.EQLTQGKP-LPEFDLIFIDADKRNYPRYYEIGLNLLRRGGLMVIDNVLWHGKVTEV-DPQEAQTQV-----LQQFNRDLAQDERVRISVIPLGDGMTLALKK
Q50859_MYXXA/16-220 RDSSVR--DNDILRDLREETSKLP-.LRTMQIPPEQGQLLSLLVRLIGARKTLEVGVFTGYSTLCAALALPADGRVIACDLSEEWVSIARRYWQRAGVADRIEVRLGDAHHSL.EALVGSEH-RGTFDLAFIDADKESYDFYYEHALRLVRPGGLIILDNTLWSGKVADPSVVGDPETDS-----LRRINAKLLTDERVDLSMLPIADGLTLARKR
MDMC_STRMY/16-220 RSVALR--EDGLLRELHDMTAQLPG.GRAMQIMPEEAQFLGLLIRLVGARRVLEIGTFTGYSTLCMARALPAGGRIVTCDISDKWPGIGAPFWQRAGVDGLIDLRIGDAARTL.AELRERDG-DGAFDLVFVDADKAGYLHYYEQALALVRPGGLVAIDNTLFFGRVADP-AADDPDTVA-----VRTLNDLLRDDERVDIALLTVADGITLARRR
CAMT_STELP/29-240 LDTSVFPRESEHLKELRKATESHP-.MSFMGTSPLAGQLLSFMLKTVKPKKTIEVGVFTGYSLLATALSIPDDGKITAVDIDREAYNVGLALIKKAGVESKISFIVSDAMTLL.DDLLADGRYQGSYDFAFVDADKTNYVNYHERLIELVKVGGIIAYDNTLWGG-TVALPESEVPDFMKNNWVCVTKLNEILGSDARIDIAHLPVGDGITFCRRV
CAMT_EUCGU/34-245 LETSVYPREPEPMKELREITAKHP-.WNIMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFREGPALPIL.DQLIEDGK-QGSFDFIFVDADKDNYLNYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI
CAMT_POPKI/21-234 YETSAYPGEHEQLKELREATTKKYGsLSGMSVPVDEGRFLSMLLKLMNAKRTLEVGVFTGYSLLSTALALPEDGQVTAIDKDRGAYEIGLPFIQKAGVEDKINFIQSEAPPILnEMLCNDKQ--PEFDFAFVDADKSSYKHYHEQLLKLVKIGGIIAYDNTLWYGLVAKEVDDEVPEPLRMVRTVIMEFNKLLSSDLRVEISQISIGDGVTLCRRL
CAMT1_ARATH/21-231 METSAYPREHELLKELRKATVQKYGnLSEMEVPVDEGHFLSMLVKIMNAKNTIEIGVFTGYSLLTTALALPEDGRITAIDIDKEAYEVGLEFIKKAGVDHKINFIHSDGLKAL.DQLVNDKC---EFDFAFADADKSSYVNFHERLLKLVKVGGIIAFDNTLWFGFVAED-EDGVPEHMREYRAALIEFNKKLALDPRVEVSQISIGDGITLCRRL
O67476_AQUAE/14-212 EEHSSE--LHPILEELVEFTYKNTD.LPQMMVGRAEGNFLKMLVEISGAKRVLEIGTFTGFSALMMAQGLPEDGKLTTIEVNPEYAQMAKSFIERAPWGKKIEVIVGDARKVL.EEFKKES-----FDFIFIDADKSSYPYYYEKCLELLKKGRLMAIDNALWEGKVLEP-DDNRSKAIA-------RMNEMIKEDPRVEKVLLTVRDGIFLVRKI