EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01517 alignment
(4 sequences with 196 aa)


AANT_HDVP1/1-194 MSQTVARLTSKE.REEILEQWVEERKNRRKLEKDLRRANKKIKKLEDENPWLGNVVGLLRR.KKDEDGAPPAKRPRQETMEVDSGPGRKPKARGFTDQERRDHRRRKALENKKKQLAGGGKHLSQEEEEELRRLARDDDERERRTAGPRPGGVNPMDGPPRGAPGGGFVPSLQGVPESPFSRTGEGIDIRGTQQFP
O71020_HDV/1-194 MSQPDSRRPRRG.REEQLGKWIDARRRKEELERDLRKVNKTIKRLEEDNPWLGNVRGIIRK.DKDGEGAPPAKRARTDQMEVDSGPRKRKHPGGFTEQERRDHRRRKALENKKKQLSSGGKNLSREEEEELRRLTEEDERRERRVAGPRVGDVNPLDGGPRGAPGGGFVPSMHDIPESPFTRRGDGLDVRGAQEFP
AANT_HDVS1/1-195 MSQSETRRGRRGtREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIRK.GKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGKILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFSRTGEGLDIRGTQGFP
AANT_HDVAM/1-195 MSRSERRKDRGG.REDILEQWVSGRKKLEELERDLRKLKKKIKKLEEDNPWLGNIKGIIGKkDKDGEGAPPAKKLRMDQMEIDAGPRKRPLRGGFTDKERQDHRRRKALENKRKQLSSGGKSLSREEEEELKRLTEEDEKRERRIAGPSVGGVNPLEGGSRGAPGGGFVPSMQGVPESPFARTGEGLDIRGSQGFP